Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse GABARAP Monoclonal Antibody | anti-GABARAP antibody

GABARAP (GABA(A) Receptor-Associated Protein, FLJ25768, MGC120154, MGC120155, MM46) (MaxLight 490)

Gene Names
GABARAP; MM46; ATG8A; GABARAP-a
Applications
Western Blot
Purity
Purified
Synonyms
GABARAP; Monoclonal Antibody; GABARAP (GABA(A) Receptor-Associated Protein; FLJ25768; MGC120154; MGC120155; MM46) (MaxLight 490); GABA(A) Receptor-Associated Protein; MM46; anti-GABARAP antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G7
Specificity
Recognizes GABARAP.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-GABARAP antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GABARAP (NP_009209.1, 1aa-117aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GABARAP antibody
Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. [provided by RefSeq]
Product Categories/Family for anti-GABARAP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,918 Da
NCBI Official Full Name
gamma-aminobutyric acid receptor-associated protein
NCBI Official Synonym Full Names
GABA(A) receptor-associated protein
NCBI Official Symbol
GABARAP
NCBI Official Synonym Symbols
MM46; ATG8A; GABARAP-a
NCBI Protein Information
gamma-aminobutyric acid receptor-associated protein
UniProt Protein Name
Gamma-aminobutyric acid receptor-associated protein
UniProt Gene Name
GABARAP
UniProt Synonym Gene Names
FLC3B
UniProt Entry Name
GBRAP_HUMAN

NCBI Description

Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. [provided by RefSeq, Jul 2008]

Uniprot Description

GABARAP: is a ubiquitin-like protein that is a constituent of the ATG8-conjugation system, one of two evolutionarily conserved phosphatidylethanolamine conjugation systems necessary for the formation of the autophagosome. The human ATG8 system includes seven ubiquitin-like light chain proteins (LCPs) that are homologs of yeast LC3: MAP1LC3A, -B, -C, GABARAP, GABARAPL1, -2, and -3. Pro-LCPs are cleaved by ATG4B to expose a C-terminal glycine residue, the cytosolic LCP-I form. The exposed C-terminus is conjugated to the head group amine of phosphatidylethanolamine (PE) through an amide bond by a sequence of ubiquitination-like reactions that involves an E1 (ATG7), an E2 (ATG3), and an E3 (a complex including ATG5, ATG12, and ATG16L). The PE-congugated form (LCP-II) is tightly associated with the autophagosomal membrane. The LCP-II forms can also be delipidated by the ATG4 proteases: most of the LCPs are delipidated and liberated from the membrane before autophagosomes fuse with lysosomes. May play a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton. Belongs to the MAP1 LC3 family. Interacts with GPHN and NSF. Interacts with GABRG2, beta-tubulin and ULK1.

Protein type: Autophagy; Ubiquitin-like modifier; Adaptor/scaffold; Microtubule-binding; Vesicle

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: microtubule; smooth endoplasmic reticulum; lysosome; autophagic vacuole; cytosol; actin cytoskeleton; Golgi membrane; microtubule associated complex; extrinsic to membrane; perinuclear region of cytoplasm; plasma membrane; axoneme; cytoplasmic vesicle

Molecular Function: protein binding; microtubule binding; beta-tubulin binding; GABA receptor binding

Biological Process: synaptic transmission; induction of apoptosis via death domain receptors; mitochondrion degradation; microtubule cytoskeleton organization and biogenesis; protein targeting; autophagic vacuole formation

Research Articles on GABARAP

Similar Products

Product Notes

The GABARAP gabarap (Catalog #AAA6206351) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GABARAP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GABARAP gabarap for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GABARAP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.