Mouse anti-Human G3BP1 Monoclonal Antibody | anti-G3BP1 antibody

G3BP1 (Ras GTPase-activating Protein-binding Protein 1, G3BP-1, ATP-dependent DNA Helicase VIII, hDH VIII, GAP SH3 Domain-binding Protein 1, G3BP) (HRP)

Cat. Num. AAA6152606

• Gene Names: G3BP1; G3BP; HDH-VIII
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: G3BP1; Monoclonal Antibody; G3BP1 (Ras GTPase-activating Protein-binding Protein 1; G3BP-1; ATP-dependent DNA Helicase VIII; hDH VIII; GAP SH3 Domain-binding Protein 1; G3BP) (HRP); anti-G3BP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2F3
• Specificity: Recognizes human G3BP.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-G3BP1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa214-303 from G3BP (AAH06997) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB)

(Western Blot analysis of G3BP expression in transfected 293T cell line by G3BP monoclonal antibody Lane 1: G3BP transfected lysate (52.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to G3BP on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 1ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to G3BP on HeLa cell. [antibody concentration 10ug/ml])

Western Blot (WB)

(Western blot analysis of G3BP over-expressed 293 cell line, cotransfected with G3BP Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with G3BP monoclonal antibody GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB)

(G3BP monoclonal antibody Western Blot analysis of G3BP expression in A-431)

Product Categories/Family for anti-G3BP1 antibody

Antibodies; GTPase; Rab; Ras; Rho Proteins

References

1. Progressive loss of dopaminergic neurons induced by unilateral rotenone infusion into the medial forebrain bundle. Norazit A, Meedeniya AC, Nguyen MN, Mackay-Sim A.Brain Res. 2010 Aug 28.

NCBI and Uniprot Product Information

• NCBI GI #: 13937793
• NCBI GeneID: 10146
• Molecular Weight: 13,874 Da
• NCBI Official Full Name: Homo sapiens GTPase activating protein (SH3 domain) binding protein 1, mRNA
• NCBI Official Synonym Full Names: G3BP stress granule assembly factor 1
• NCBI Official Symbol: G3BP1
• NCBI Official Synonym Symbols: G3BP; HDH-VIII
• NCBI Protein Information: ras GTPase-activating protein-binding protein 1
• Protein Family: Ras GTPase-activating protein-binding protein

NCBI Description

This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jul 2008]