Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human G-Protein Coupled Receptor 161 Monoclonal Antibody | anti-GPR161 antibody

G-Protein Coupled Receptor 161 (G-Protein-coupled Receptor 161, G-protein Coupled Receptor 161, GPR161, G-protein Coupled Receptor RE2, FLJ33952, RE2) (AP)

Gene Names
GPR161; RE2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
G-Protein Coupled Receptor 161; Monoclonal Antibody; G-Protein Coupled Receptor 161 (G-Protein-coupled Receptor 161; G-protein Coupled Receptor 161; GPR161; G-protein Coupled Receptor RE2; FLJ33952; RE2) (AP); anti-GPR161 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B2
Specificity
Recognizes human GPR161.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
8437
Applicable Applications for anti-GPR161 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa362-461 from GPR161 (NP_722561) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SNRITDLGLSPHLTALMAGGQPLGHSSSTGDTGFSCSQDSGTDMMLLEDYTSDDNPPSHCTCPPKRRSSVTFEDEVEQIKEAAKNSILHVKAEVHKSLD*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Testing Data

(Detection limit for recombinant GST tagged GPR161 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GPR161 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-GPR161 antibody
GPR161/RE2 is an Orphan-U GPCR with an unknown ligand. RE2 is a member of the rhodopsin family of G protein-coupled receptors and may aid in the regulation of aggression and appetite. ESTs have been identified in brain, colon, heart/melanocyte/uterus, lung, prostate, and uterus libraries.
Product Categories/Family for anti-GPR161 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens G protein-coupled receptor 161 (GPR161), transcript variant 3, mRNA
NCBI Official Synonym Full Names
G protein-coupled receptor 161
NCBI Official Symbol
GPR161
NCBI Official Synonym Symbols
RE2
NCBI Protein Information
G-protein coupled receptor 161
UniProt Protein Name
G-protein coupled receptor 161
UniProt Gene Name
GPR161
UniProt Entry Name
GP161_HUMAN

NCBI Description

The protein encoded by this gene is an orphan G protein-coupled receptor whose ligand is unknown. This gene is overexpressed in triple-negative breast cancer, and disruption of this gene slows the proliferation of basal breast cancer cells. Therefore, this gene is a potential drug target for triple-negative breast cancer. [provided by RefSeq, Mar 2017]

Uniprot Description

GPR161: Orphan receptor. Plays a role in neurulation and lens development. Belongs to the G-protein coupled receptor 1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; GPCR, family 1; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 1q24.2

Cellular Component: recycling endosome; integral to membrane

Molecular Function: G-protein coupled receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; multicellular organismal development; positive regulation of cAMP biosynthetic process

Research Articles on GPR161

Similar Products

Product Notes

The GPR161 gpr161 (Catalog #AAA6131388) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The G-Protein Coupled Receptor 161 (G-Protein-coupled Receptor 161, G-protein Coupled Receptor 161, GPR161, G-protein Coupled Receptor RE2, FLJ33952, RE2) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's G-Protein Coupled Receptor 161 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GPR161 gpr161 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "G-Protein Coupled Receptor 161, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.