Mouse anti-Human FOXO3A Monoclonal Antibody | anti-FOXO3A antibody

FOXO3A (Forkhead Box O3A, Forkhead in Rhabdomyosarcoma-like 1, AF6q21 Protein, DKFZp781A0677, FKHR2, FKHRL1, FKHRL1P2, MGC12739, MGC31925) (HRP)

Cat. Num. AAA6152565

• Gene Names: FOXO3; FOXO2; AF6q21; FKHRL1; FOXO3A; FKHRL1P2
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FOXO3A; Monoclonal Antibody; FOXO3A (Forkhead Box O3A; Forkhead in Rhabdomyosarcoma-like 1; AF6q21 Protein; DKFZp781A0677; FKHR2; FKHRL1; FKHRL1P2; MGC12739; MGC31925) (HRP); anti-FOXO3A antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1B11
• Specificity: Recognizes human FOXO3A.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 3300

• Applicable Applications for anti-FOXO3A antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa361-460 from human FOXO3A (AAH21224) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKGSGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFS
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to FOXO3A on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXO3 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged FOXO3A is ~0.03ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between IKBKB and FOXO3. HeLa cells were stained with IKBKB rabbit purified polyclonal 1:1200 and FOXO3 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Product Categories/Family for anti-FOXO3A antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 33871764
• NCBI GeneID: 2309
• NCBI Official Full Name: Homo sapiens forkhead box O3, mRNA
• NCBI Official Synonym Full Names: forkhead box O3
• NCBI Official Symbol: FOXO3
• NCBI Official Synonym Symbols: FOXO2; AF6q21; FKHRL1; FOXO3A; FKHRL1P2
• NCBI Protein Information: forkhead box protein O3

NCBI Description

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed. [provided by RefSeq, Jul 2008]