Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FOXO1A monoclonal antibody (M12), clone 3A10 Western Blot analysis of FOXO1A expression in SW-13 (Cat # L005V1).)

Mouse FOXO1A Monoclonal Antibody | anti-FOXO1A antibody

FOXO1A (Forkhead Box O1, FKH1, FKHR, FOXO1A) (HRP)

Gene Names
FOXO1; FKH1; FKHR; FOXO1A
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
FOXO1A; Monoclonal Antibody; FOXO1A (Forkhead Box O1; FKH1; FKHR; FOXO1A) (HRP); Forkhead Box O1; anti-FOXO1A antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a, lambda
Clone Number
3A10
Specificity
Recognizes FOXO1A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-FOXO1A antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FOXO1A (NP_002006, 452aa-555aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FOXO1A monoclonal antibody (M12), clone 3A10 Western Blot analysis of FOXO1A expression in SW-13 (Cat # L005V1).)

Western Blot (WB) (FOXO1A monoclonal antibody (M12), clone 3A10 Western Blot analysis of FOXO1A expression in SW-13 (Cat # L005V1).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FOXO1A on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to FOXO1A on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FOXO1A on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to FOXO1A on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXO1 on HeLa cell. [antibody concentration 15 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FOXO1 on HeLa cell. [antibody concentration 15 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FOXO1 on HeLa cell. [antibody concentration 15 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FOXO1 on HeLa cell. [antibody concentration 15 ug/ml])
Product Categories/Family for anti-FOXO1A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
69,662 Da
NCBI Official Full Name
forkhead box protein O1
NCBI Official Synonym Full Names
forkhead box O1
NCBI Official Symbol
FOXO1
NCBI Official Synonym Symbols
FKH1; FKHR; FOXO1A
NCBI Protein Information
forkhead box protein O1; forkhead box protein O1A; forkhead, Drosophila, homolog of, in rhabdomyosarcoma
UniProt Protein Name
Forkhead box protein O1
Protein Family
UniProt Gene Name
FOXO1
UniProt Synonym Gene Names
FKHR; FOXO1A
UniProt Entry Name
FOXO1_HUMAN

NCBI Description

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq, Jul 2008]

Uniprot Description

FOXO1A: a transcription factor of the forkhead family. A central regulator of metabolism in several cell types. May play an important role in myogenic growth and differentiation, and in the regulation of lipolysis in adipocytes by controlling the expression of adipose triglyceride lipase (ATGL), the rate-limiting lipolytic enzyme. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. Contains 1 fork-head domain.

Protein type: Nuclear receptor co-regulator; DNA-binding; Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 13q14.1

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; protein phosphatase 2A binding; sequence-specific DNA binding; ubiquitin protein ligase binding; chromatin binding

Biological Process: transcription from RNA polymerase II promoter; fat cell differentiation; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; apoptosis; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter; thermoregulation; positive regulation of gluconeogenesis; positive regulation of autophagy; epidermal growth factor receptor signaling pathway; blood vessel development; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; negative regulation of fat cell differentiation; negative regulation of stress-activated MAPK cascade; cellular response to starvation; endocrine pancreas development; protein amino acid acetylation; cellular response to insulin stimulus; insulin receptor signaling pathway; positive regulation of protein catabolic process; autophagy; cell glucose homeostasis; innate immune response; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; response to DNA damage stimulus; negative regulation of apoptosis

Disease: Rhabdomyosarcoma 2

Research Articles on FOXO1A

Similar Products

Product Notes

The FOXO1A foxo1 (Catalog #AAA6180369) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FOXO1A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FOXO1A foxo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FOXO1A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.