Western Blot (WB)
(Host: RabbitTarget Name: OASLSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Rabbit Oasl1 Polyclonal Antibody | anti-OASL1 antibody
Oasl1 antibody - C-terminal region
Gene Names
Oasl1; oasl9; 7530414C13Rik
Reactivity
Tested Reactivity: MousePredicted Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Oasl1; Polyclonal Antibody; Oasl1 antibody - C-terminal region; anti-OASL1 antibody
Host
Rabbit
Reactivity
Tested Reactivity: Mouse
Predicted Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Predicted Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml (varies by lot)
Sequence
ICLLDTISPEIQVFVKNPDGRSHAYAIHPLDYVLNLKQQIEDRQGLRCQE
Applicable Applications for anti-OASL1 antibody
Western Blot (WB)
Protein Size (# AA)
511 amino acids
Protein Interactions
DSK2; VPS9; NUB1; UBQLN1; SQSTM1; RAD23B; PSMD4; NBR1;
Blocking Peptide
For anti-Oasl1 (MBS3205263) antibody is Catalog # MBS3230228
Replacement Item
This antibody may replace item sc-150147 from Santa Cruz Biotechnology.
Predicted Homology
Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: OASLSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: OASLSample Tissue: Mouse KidneyAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-Oasl1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Western Blot (WB)
(WB Suggested Anti-Oasl1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Brain)
Related Product Information for anti-OASL1 antibody
The function of this protein remains unknown.
Product Categories/Family for anti-OASL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
2'-5'-oligoadenylate synthase-like protein 1 isoform a
NCBI Official Synonym Full Names
2'-5' oligoadenylate synthetase-like 1
NCBI Official Symbol
Oasl1
NCBI Official Synonym Symbols
oasl9; 7530414C13Rik
NCBI Protein Information
2'-5'-oligoadenylate synthase-like protein 1
UniProt Protein Name
2'-5'-oligoadenylate synthase-like protein 1
UniProt Gene Name
Oasl1
UniProt Synonym Gene Names
oasl9
UniProt Entry Name
OASL1_MOUSE
Uniprot Description
OASL: a protein of the 2'-5'-oligoadenylate synthetase family, but does not have 2'-5'-OAS activity. Binds double-stranded RNA and DNA. Interacts with the ligand binding domain of the thyroid receptor (TR). Does not require the presence of thyroid hormone for its interaction. Contains a ubiquitin-like domain that interacts with methyl CpG-binding protein 1.
Protein type: Nucleolus; DNA-binding
Cellular Component: membrane; cytoplasm; nucleolus; nucleus
Molecular Function: transferase activity; DNA binding; RNA binding; double-stranded RNA binding; ATP binding; 2'-5'-oligoadenylate synthetase activity
Biological Process: negative regulation of viral genome replication; immune system process; response to virus; innate immune response; immune response; defense response to virus
Research Articles on OASL1
Similar Products
Product Notes
The OASL1 oasl1 (Catalog #AAA3205263) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Oasl1 antibody - C-terminal region reacts with Tested Reactivity: Mouse Predicted Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's Oasl1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OASL1 oasl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ICLLDTISPE IQVFVKNPDG RSHAYAIHPL DYVLNLKQQI EDRQGLRCQE. It is sometimes possible for the material contained within the vial of "Oasl1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
