Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FKBP10 monoclonal antibody (M02), clone 3B5. Western Blot analysis of FKBP10 expression in HepG2.)

Mouse FKBP10 Monoclonal Antibody | anti-FKBP10 antibody

FKBP10 (FK506 Binding Protein 10, 65kD, FKBP6, FKBP65, FLJ20683, FLJ22041, FLJ23833, hFKBP65) (Biotin)

Gene Names
FKBP10; OI6; OI11; BRKS1; FKBP65; PPIASE; hFKBP65
Applications
Western Blot
Purity
Purified
Synonyms
FKBP10; Monoclonal Antibody; FKBP10 (FK506 Binding Protein 10; 65kD; FKBP6; FKBP65; FLJ20683; FLJ22041; FLJ23833; hFKBP65) (Biotin); FK506 Binding Protein 10; 65 kD; hFKBP65; anti-FKBP10 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B5
Specificity
Recognizes FKBP10.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-FKBP10 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FKBP10 (NP_068758, 377aa-470aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ADVVEIRTLSRPSETCNETTKLGDFVRYHYNCSLLDGTQLFTSHDYGAPQEATLGANKVIEGLDTGLQGMCVGERRQLIVPPHLAHGESGARGV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(FKBP10 monoclonal antibody (M02), clone 3B5. Western Blot analysis of FKBP10 expression in HepG2.)

Western Blot (WB) (FKBP10 monoclonal antibody (M02), clone 3B5. Western Blot analysis of FKBP10 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged FKBP10 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FKBP10 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-FKBP10 antibody
The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase family. It is located in endoplasmic reticulum and acts as molecular chaperones. An alternatively spliced variant encoding different isoform has been found, but the biological validity of the variant is not determined. [provided by RefSeq]
Product Categories/Family for anti-FKBP10 antibody
References
1. A novel splicing mutation in FKBP10 causing osteogenesis imperfecta with a possible mineralization defect. Venturi G, Monti E, Carbonare LD, Corradi M, Gandini A, Valenti MT, Boner A, Antoniazzi F.Bone. 2011 Oct 30.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP10
NCBI Official Synonym Full Names
FKBP prolyl isomerase 10
NCBI Official Symbol
FKBP10
NCBI Official Synonym Symbols
OI6; OI11; BRKS1; FKBP65; PPIASE; hFKBP65
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP10
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP10
UniProt Gene Name
FKBP10
UniProt Synonym Gene Names
FKBP65; PSEC0056; PPIase FKBP10; 65 kDa FKBP; FKBP-65; FKBP-10
UniProt Entry Name
FKB10_HUMAN

NCBI Description

The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. This protein localizes to the endoplasmic reticulum and acts as a molecular chaperone. Alternatively spliced variants encoding different isoforms have been reported, but their biological validity has not been determined.[provided by RefSeq, Nov 2009]

Uniprot Description

FKBP10: PPIases accelerate the folding of proteins during protein synthesis. Defects in FKBP10 are the cause of osteogenesis imperfecta type 6 (OI6). OI6 is a moderate to severe, autosomal recessive form of osteogenesis imperfecta characterized by increased serum alkaline phosphatase levels and bone histology exhibiting a fish scale-like lamellar pattern. Osteogenesis imperfecta defines a group of connective tissue disorders characterized by bone fragility and low bone mass.

Protein type: EC 5.2.1.8; Isomerase

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum lumen

Molecular Function: peptidyl-prolyl cis-trans isomerase activity; FK506 binding; calcium ion binding

Biological Process: protein peptidyl-prolyl isomerization

Disease: Osteogenesis Imperfecta, Type Xi; Bruck Syndrome 1

Research Articles on FKBP10

Similar Products

Product Notes

The FKBP10 fkbp10 (Catalog #AAA6173638) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FKBP10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FKBP10 fkbp10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FKBP10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.