Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FKBP10Antibody Dilution: 1.0ug/mlSample Type: PANC1 cell lysateFKBP10 is supported by BioGPS gene expression data to be expressed in PANC1)

Rabbit FKBP10 Polyclonal Antibody | anti-FKBP10 antibody

FKBP10 antibody - C-terminal region

Gene Names
FKBP10; OI6; OI11; BRKS1; FKBP65; PPIASE; hFKBP65
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
FKBP10; Polyclonal Antibody; FKBP10 antibody - C-terminal region; anti-FKBP10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GKGRLMPGQDPEKTIGDMFQNQDRNQDGKITVDELKLKSDEDEERVHEEL
Sequence Length
582
Applicable Applications for anti-FKBP10 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FKBP10Antibody Dilution: 1.0ug/mlSample Type: PANC1 cell lysateFKBP10 is supported by BioGPS gene expression data to be expressed in PANC1)

Western Blot (WB) (Host: RabbitTarget Name: FKBP10Antibody Dilution: 1.0ug/mlSample Type: PANC1 cell lysateFKBP10 is supported by BioGPS gene expression data to be expressed in PANC1)
Related Product Information for anti-FKBP10 antibody
This is a rabbit polyclonal antibody against FKBP10. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. This protein localizes to the endoplasmic reticulum and acts as a molecular chaperone. Alternatively spliced variants encoding different isoforms have been reported, but their biological validity has not been determined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
peptidyl-prolyl cis-trans isomerase FKBP10
NCBI Official Synonym Full Names
FKBP prolyl isomerase 10
NCBI Official Symbol
FKBP10
NCBI Official Synonym Symbols
OI6; OI11; BRKS1; FKBP65; PPIASE; hFKBP65
NCBI Protein Information
peptidyl-prolyl cis-trans isomerase FKBP10
UniProt Protein Name
Peptidyl-prolyl cis-trans isomerase FKBP10
UniProt Gene Name
FKBP10
UniProt Synonym Gene Names
FKBP65; PSEC0056; PPIase FKBP10; 65 kDa FKBP; FKBP-65; FKBP-10
UniProt Entry Name
FKB10_HUMAN

NCBI Description

The protein encoded by this gene belongs to the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. This protein localizes to the endoplasmic reticulum and acts as a molecular chaperone. Alternatively spliced variants encoding different isoforms have been reported, but their biological validity has not been determined.[provided by RefSeq, Nov 2009]

Uniprot Description

FKBP10: PPIases accelerate the folding of proteins during protein synthesis. Defects in FKBP10 are the cause of osteogenesis imperfecta type 6 (OI6). OI6 is a moderate to severe, autosomal recessive form of osteogenesis imperfecta characterized by increased serum alkaline phosphatase levels and bone histology exhibiting a fish scale-like lamellar pattern. Osteogenesis imperfecta defines a group of connective tissue disorders characterized by bone fragility and low bone mass.

Protein type: EC 5.2.1.8; Isomerase

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum lumen

Molecular Function: peptidyl-prolyl cis-trans isomerase activity; FK506 binding; calcium ion binding

Biological Process: protein peptidyl-prolyl isomerization

Disease: Osteogenesis Imperfecta, Type Xi; Bruck Syndrome 1

Research Articles on FKBP10

Similar Products

Product Notes

The FKBP10 fkbp10 (Catalog #AAA3216642) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FKBP10 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FKBP10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FKBP10 fkbp10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GKGRLMPGQD PEKTIGDMFQ NQDRNQDGKI TVDELKLKSD EDEERVHEEL. It is sometimes possible for the material contained within the vial of "FKBP10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.