Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Mouse FGR Monoclonal Antibody | anti-FGR antibody

FGR (Tyrosine-protein Kinase Fgr, Gardner-Rasheed Feline Sarcoma Viral (v-fgr) Oncogene Homolog, Proto-oncogene c-Fgr, p55-Fgr, p58-Fgr, p58c-Fgr, SRC2) (PE)

Gene Names
FGR; SRC2; c-fgr; c-src2; p55-Fgr; p58-Fgr; p55c-fgr; p58c-fgr
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FGR; Monoclonal Antibody; FGR (Tyrosine-protein Kinase Fgr; Gardner-Rasheed Feline Sarcoma Viral (v-fgr) Oncogene Homolog; Proto-oncogene c-Fgr; p55-Fgr; p58-Fgr; p58c-Fgr; SRC2) (PE); anti-FGR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B12
Specificity
Recognizes human FGR. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
2379
Applicable Applications for anti-FGR antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human FGR (AAH64382) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.53kD).)

Western Blot (WB)

(FGR monoclonal antibody. Western Blot analysis of FGR expression in HeLa.)

Western Blot (WB) (FGR monoclonal antibody. Western Blot analysis of FGR expression in HeLa.)

Western Blot (WB)

(FGR monoclonal antibody. Western Blot analysis of FGR expression in PC-12.)

Western Blot (WB) (FGR monoclonal antibody. Western Blot analysis of FGR expression in PC-12.)

Western Blot (WB)

(FGR monoclonal antibody. Western Blot analysis of FGR expression in Raw 264.7.)

Western Blot (WB) (FGR monoclonal antibody. Western Blot analysis of FGR expression in Raw 264.7.)

Western Blot (WB)

(Western Blot analysis of FGR expression in transfected 293T cell line by FGR monoclonal antibody. Lane 1: FGR transfected lysate (59.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FGR expression in transfected 293T cell line by FGR monoclonal antibody. Lane 1: FGR transfected lysate (59.5kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml.)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3ug/ml.)

Testing Data

(Detection limit for recombinant GST tagged FGR is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FGR is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-FGR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, mRNA
NCBI Official Synonym Full Names
FGR proto-oncogene, Src family tyrosine kinase
NCBI Official Symbol
FGR
NCBI Official Synonym Symbols
SRC2; c-fgr; c-src2; p55-Fgr; p58-Fgr; p55c-fgr; p58c-fgr
NCBI Protein Information
tyrosine-protein kinase Fgr
Protein Family

NCBI Description

This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]

Research Articles on FGR

Similar Products

Product Notes

The FGR (Catalog #AAA6157812) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FGR (Tyrosine-protein Kinase Fgr, Gardner-Rasheed Feline Sarcoma Viral (v-fgr) Oncogene Homolog, Proto-oncogene c-Fgr, p55-Fgr, p58-Fgr, p58c-Fgr, SRC2) (PE) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FGR can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGR for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.