Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (FGL2 monoclonal antibody Western Blot analysis of FGL2 expression in Raw 264.7.)

Mouse FGL2 Monoclonal Antibody | anti-FGL2 antibody

FGL2 (Fibroleukin, Fibrinogen-like Protein 2, pT49) APC

Gene Names
FGL2; T49; pT49
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FGL2; Monoclonal Antibody; FGL2 (Fibroleukin; Fibrinogen-like Protein 2; pT49) APC; anti-FGL2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6D9
Specificity
Recognizes human FGL2. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FGL2 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
IHC-P: 0.5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa24-123 from human FGL2 (NP_006673) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(FGL2 monoclonal antibody Western Blot analysis of FGL2 expression in Raw 264.7.)

Western Blot (WB) (FGL2 monoclonal antibody Western Blot analysis of FGL2 expression in Raw 264.7.)

Western Blot (WB)

(Western Blot analysis of FGL2 expression in transfected 293T cell line by FGL2 monoclonal antibody Lane 1: FGL2 transfected lysate (50kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FGL2 expression in transfected 293T cell line by FGL2 monoclonal antibody Lane 1: FGL2 transfected lysate (50kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FGL2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to FGL2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5ug/ml].)

Immunoprecipitation (IP)

(Immunoprecipitation of FGL2 transfected lysate using FGL2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FGL2 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of FGL2 transfected lysate using FGL2 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FGL2 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged FGL2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FGL2 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(FGL2 monoclonal antibody Western Blot analysis of FGL2 expression in PC-12.)

Western Blot (WB) (FGL2 monoclonal antibody Western Blot analysis of FGL2 expression in PC-12.)

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)
Product Categories/Family for anti-FGL2 antibody
References
1. FGL2/Fibroleukin Mediates Hepatic Reperfusion Injury by Induction of Sinusoidal Endothelial Cell and Hepatocyte Apoptosis in Mice. Selzner N, Liu H, Boehnert MU, Adeyi OA, Shalev I, Bartczak AM, Xue-Zhong M, Manuel J, Rotstein OD, McGilvray ID, Grant DR, Phillips MJ, Levy GA, Selzner M.J Hepatol. 2011 Jul 11. 2. The FGL2/fibroleukin prothrombinase is involved in alveolar macrophage activation in COPD through the MAPK pathway. Liu Y, Xu S, Xiao F, Xiong Y, Wang X, Gao S, Yan W, Ning Q.Biochem Biophys Res Commun. 2010 May 7. 3. Targeted Deletion of fgl2 Leads to Impaired Regulatory T Cell Activity and Development of Autoimmune Glomerulonephritis1. Shalev I, Liu H, Koscik C, Bartczak A, Javadi M, Wong KM, Maknojia A, He W, Liu MF, Diao J, Winter E, Manuel J, McCarthy D, Cattral M, Gommerman J, Clark DA, Phillips MJ, Gorczynski RR, Zhang L, Downey G, Grant D, Cybulsky MI, Levy G.J Immunol. 2008 Jan 1;180(1):249-60. 4. Expression of Prothrombin and Protease Activated Receptors in Human Myometrium During Pregnancy and Labor. O'brien M, Morrison JJ, Smith TJ.Biol Reprod. 2008 Jan;78(1):20-6. Epub 2007 Sep 26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48
NCBI Official Full Name
fibroleukin
NCBI Official Synonym Full Names
fibrinogen like 2
NCBI Official Symbol
FGL2
NCBI Official Synonym Symbols
T49; pT49
NCBI Protein Information
fibroleukin
UniProt Protein Name
Fibroleukin
Protein Family
UniProt Gene Name
FGL2
UniProt Entry Name
FGL2_HUMAN

NCBI Description

The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites. [provided by RefSeq, Jul 2008]

Uniprot Description

FGL2: May play a role in physiologic lymphocyte functions at mucosal sites.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: fibrinogen complex

Research Articles on FGL2

Similar Products

Product Notes

The FGL2 fgl2 (Catalog #AAA6136599) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FGL2 (Fibroleukin, Fibrinogen-like Protein 2, pT49) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FGL2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Immunoprecipitation (IP), Western Blot (WB). IHC-P: 0.5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FGL2 fgl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FGL2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.