Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse FFAR2 Monoclonal Antibody | anti-FFAR2 antibody

FFAR2 (Free Fatty Acid Receptor 2, FFA2R, GPR43) (MaxLight 405)

Gene Names
FFAR2; FFA2R; GPR43
Applications
Western Blot
Purity
Purified
Synonyms
FFAR2; Monoclonal Antibody; FFAR2 (Free Fatty Acid Receptor 2; FFA2R; GPR43) (MaxLight 405); Free Fatty Acid Receptor 2; GPR43; anti-FFAR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3B3
Specificity
Recognizes FFAR2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-FFAR2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FFAR2 (NP_005297.1, 231aa-330aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-FFAR2 antibody
This gene encodes a member of the GP40 family of G protein-coupled receptors that are clustered together on chromosome 19. The encoded protein is a receptor for short chain free fatty acids and may be involved in the inflammatory response and in regulating lipid plasma levels. [provided by RefSeq]
Product Categories/Family for anti-FFAR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,144 Da
NCBI Official Full Name
free fatty acid receptor 2
NCBI Official Synonym Full Names
free fatty acid receptor 2
NCBI Official Symbol
FFAR2
NCBI Official Synonym Symbols
FFA2R; GPR43
NCBI Protein Information
free fatty acid receptor 2; G protein-coupled receptor 43; G-protein coupled receptor 43; free fatty acid activated receptor 2
UniProt Protein Name
Free fatty acid receptor 2
Protein Family
UniProt Gene Name
FFAR2
UniProt Synonym Gene Names
GPR43
UniProt Entry Name
FFAR2_HUMAN

NCBI Description

This gene encodes a member of the GP40 family of G protein-coupled receptors that are clustered together on chromosome 19. The encoded protein is a receptor for short chain free fatty acids and may be involved in the inflammatory response and in regulating lipid plasma levels. [provided by RefSeq, Apr 2009]

Uniprot Description

FFAR2: Receptor for short chain fatty acids through a G(i)- protein-mediated inhibition of adenylyl cyclase and elevation of intracellular calcium. The rank order of potency for agonists of this receptor is acetate= propionate = butyrate > pentanoate = formate. Belongs to the G-protein coupled receptor 1 family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Receptor, GPCR; GPCR, family 1

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: cell projection; integral to plasma membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; protein binding; lipid binding

Biological Process: fat cell differentiation; G-protein coupled receptor protein signaling pathway; sequestering of lipid; mucosal immune response; regulation of acute inflammatory response; cell surface pattern recognition receptor signaling pathway; positive regulation of cytokine production during immune response; positive regulation of acute inflammatory response to non-antigenic stimulus; glucose homeostasis; leukocyte chemotaxis during inflammatory response; positive regulation of chemokine production

Research Articles on FFAR2

Similar Products

Product Notes

The FFAR2 ffar2 (Catalog #AAA6195481) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FFAR2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FFAR2 ffar2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FFAR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.