Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human FDX1 Monoclonal Antibody | anti-FDX1 antibody

FDX1 (Adrenodoxin, Mitochondrial, Adrenal Ferredoxin, Ferredoxin-1, Hepatoredoxin, ADX) (HRP)

Gene Names
FDX1; ADX; FDX; LOH11CR1D
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FDX1; Monoclonal Antibody; FDX1 (Adrenodoxin; Mitochondrial; Adrenal Ferredoxin; Ferredoxin-1; Hepatoredoxin; ADX) (HRP); anti-FDX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1E7
Specificity
Recognizes human FDX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-FDX1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa85-183 from human FDX1 (NP_004100.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKT
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Testing Data

(Detection limit for recombinant GST tagged FDX1 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FDX1 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-FDX1 antibody
This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants of this gene have been described although the full-length nature of only two that encode different isoforms have been determined.
Product Categories/Family for anti-FDX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,393 Da
NCBI Official Full Name
adrenodoxin, mitochondrial
NCBI Official Synonym Full Names
ferredoxin 1
NCBI Official Symbol
FDX1
NCBI Official Synonym Symbols
ADX; FDX; LOH11CR1D
NCBI Protein Information
adrenodoxin, mitochondrial; adrenal ferredoxin; ferredoxin-1; hepatoredoxin; mitochondrial adrenodoxin
UniProt Protein Name
Adrenodoxin, mitochondrial
Protein Family
UniProt Gene Name
FDX1
UniProt Synonym Gene Names
ADX
UniProt Entry Name
ADX_HUMAN

NCBI Description

This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21. [provided by RefSeq, Aug 2011]

Uniprot Description

adrenodoxin: Participates in the synthesis of thyroid hormones. Essential for the synthesis of various steroid hormones, participates in the reduction of mitochondrial cytochrome P450 for steroidogenesis. Transfers electrons from adrenodoxin reductase to cytochrome P450 cholesterol side-chain cleavage enzyme. Belongs to the adrenodoxin/putidaredoxin family.

Protein type: Mitochondrial

Chromosomal Location of Human Ortholog: 11q22

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: 2 iron, 2 sulfur cluster binding; electron carrier activity; iron ion binding

Biological Process: steroid metabolic process; cholesterol metabolic process; xenobiotic metabolic process; C21-steroid hormone biosynthetic process; hormone biosynthetic process; sterol metabolic process

Research Articles on FDX1

Similar Products

Product Notes

The FDX1 fdx1 (Catalog #AAA6152490) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FDX1 (Adrenodoxin, Mitochondrial, Adrenal Ferredoxin, Ferredoxin-1, Hepatoredoxin, ADX) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FDX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FDX1 fdx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FDX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.