Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human ADH6 Monoclonal Antibody | anti-ADH6 antibody

ADH6 (Alcohol Dehydrogenase 6) (Biotin)

Gene Names
ADH6; ADH-5
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ADH6; Monoclonal Antibody; ADH6 (Alcohol Dehydrogenase 6) (Biotin); anti-ADH6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4G4
Specificity
Recognizes human ADH6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
368
Applicable Applications for anti-ADH6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa55-144 from human ADH6 (NP_000663) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GSKHLDLLYPTILGHEGAGIVESIGEGVSTVKPGDKVITLFLPQCGECTSCLNSEGNFCIQFKQSKTQLMSDGTSRFTCKGKSIYHFGNT
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB)

(ADH6 monoclonal antibody, Western Blot analysis of ADH6 expression in K-562.)

Western Blot (WB) (ADH6 monoclonal antibody, Western Blot analysis of ADH6 expression in K-562.)

Testing Data

(Detection limit for recombinant GST tagged ADH6 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ADH6 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-ADH6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
130
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
alcohol dehydrogenase 6 isoform 2
NCBI Official Synonym Full Names
alcohol dehydrogenase 6 (class V)
NCBI Official Symbol
ADH6
NCBI Official Synonym Symbols
ADH-5
NCBI Protein Information
alcohol dehydrogenase 6
UniProt Protein Name
Alcohol dehydrogenase 6
Protein Family
UniProt Gene Name
ADH6
UniProt Entry Name
ADH6_HUMAN

NCBI Description

This gene encodes class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This gene is expressed in the stomach as well as in the liver, and it contains a glucocorticoid response element upstream of its 5' UTR, which is a steroid hormone receptor binding site. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

ADH6: class V alcohol dehydrogenase, which is a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This gene is expressed in the stomach as well as in the liver, and it contains a glucocorticoid response element upstream of its 5' UTR, which is a steroid hormone receptor binding site. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Protein type: Carbohydrate Metabolism - glycolysis and gluconeogenesis; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Cofactor and Vitamin Metabolism - retinol; Amino Acid Metabolism - tyrosine; Oxidoreductase; Lipid Metabolism - fatty acid; Xenobiotic Metabolism - metabolism by cytochrome P450; EC 1.1.1.1

Chromosomal Location of Human Ortholog: 4q23

Cellular Component: cytosol

Molecular Function: zinc ion binding; alcohol dehydrogenase activity; ethanol binding; alcohol dehydrogenase activity, zinc-dependent

Biological Process: response to ethanol; xenobiotic metabolic process; ethanol oxidation

Research Articles on ADH6

Similar Products

Product Notes

The ADH6 adh6 (Catalog #AAA6140499) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ADH6 (Alcohol Dehydrogenase 6) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ADH6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ADH6 adh6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ADH6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.