Western Blot (WB)
(Western Blot analysis of FCER2 expression in transfected 293T cell line by FCER2 monoclonal antibody (M03), clone S52.Lane 1: FCER2 transfected lysate (36.5 KDa).Lane 2: Non-transfected lysate.)
Mouse FCER2 Monoclonal Antibody | anti-FCER2 antibody
FCER2 (Fc fragment of IgE, low affinity II, Receptor for (CD23), CD23, CD23A, CLEC4J, FCE2, IGEBF) (PE)
Gene Names
FCER2; CD23; FCE2; CD23A; IGEBF; CLEC4J; BLAST-2
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified
Synonyms
FCER2; Monoclonal Antibody; FCER2 (Fc fragment of IgE; low affinity II; Receptor for (CD23); CD23; CD23A; CLEC4J; FCE2; IGEBF) (PE); Fc fragment of IgE; IGEBF; anti-FCER2 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
S52
Specificity
Recognizes FCER2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
321
Applicable Applications for anti-FCER2 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FCER2 (AAH14108, 1aa-321aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQGLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of FCER2 expression in transfected 293T cell line by FCER2 monoclonal antibody (M03), clone S52.Lane 1: FCER2 transfected lysate (36.5 KDa).Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of FCER2 expression in transfected 293T cell line by FCER2 monoclonal antibody (M03), clone S52.Lane 1: FCER2 transfected lysate (36.5 KDa).Lane 2: Non-transfected lysate.)
Immunoprecipitation (IP)
(Immunoprecipitation of FCER2 transfected lysate using anti-FCER2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FCER2 MaxPab rabbit polyclonal antibody.)
Immunoprecipitation (IP)
(Immunoprecipitation of FCER2 transfected lysate using anti-FCER2 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with FCER2 MaxPab rabbit polyclonal antibody.)
Related Product Information for anti-FCER2 antibody
The human leukocyte differentiation antigen CD23 (FCE2) is a key molecule for B-cell activation and growth. It is the low-affinity receptor for IgE. The truncated molecule can be secreted, then functioning as a potent mitogenic growth factor. [supplied by OMIM]
Product Categories/Family for anti-FCER2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Fc fragment of IgE, low affinity II, receptor for (CD23)
NCBI Official Synonym Full Names
Fc fragment of IgE receptor II
NCBI Official Symbol
FCER2
NCBI Official Synonym Symbols
CD23; FCE2; CD23A; IGEBF; CLEC4J; BLAST-2
NCBI Protein Information
low affinity immunoglobulin epsilon Fc receptor
Protein Family
NCBI Description
The protein encoded by this gene is a B-cell specific antigen, and a low-affinity receptor for IgE. It has essential roles in B cell growth and differentiation, and the regulation of IgE production. This protein also exists as a soluble secreted form, then functioning as a potent mitogenic growth factor. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]
Research Articles on FCER2
Similar Products
Product Notes
The FCER2 (Catalog #AAA6184114) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FCER2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FCER2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FCER2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
