Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to FBXO9 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Mouse anti-Human FBXO9 Monoclonal Antibody | anti-FBXO9 antibody

FBXO9 (FBX9, VCIA1, F-box Only Protein 9, Cross-immune Reaction Antigen 1, Renal Carcinoma Antigen NY-REN-57, dJ341E18.2, DKFZp434C0118, KIAA0936) APC

Gene Names
FBXO9; FBX9; VCIA1; NY-REN-57; dJ341E18.2
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FBXO9; Monoclonal Antibody; FBXO9 (FBX9; VCIA1; F-box Only Protein 9; Cross-immune Reaction Antigen 1; Renal Carcinoma Antigen NY-REN-57; dJ341E18.2; DKFZp434C0118; KIAA0936) APC; anti-FBXO9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G12
Specificity
Recognizes human FBXO9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-FBXO9 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa338-448 from human FBXO9 (NP_036479) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HYRLSQDTDNQTKVFAVITKKKEEKPLDYKYRYFRRVPVQEADQSFHVGLQLCSSGHQRFNKLIWIHHSCHITYKSTGETAVSAFEIDKMYTPLFFARVRSYTAFSERPL*
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to FBXO9 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Testing Data (Immunoperoxidase of monoclonal antibody to FBXO9 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged FBXO9 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FBXO9 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-FBXO9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
F-box only protein 9 isoform 1
NCBI Official Synonym Full Names
F-box protein 9
NCBI Official Symbol
FBXO9
NCBI Official Synonym Symbols
FBX9; VCIA1; NY-REN-57; dJ341E18.2
NCBI Protein Information
F-box only protein 9
UniProt Protein Name
F-box only protein 9
Protein Family
UniProt Gene Name
FBXO9
UniProt Synonym Gene Names
FBX9; VCIA1
UniProt Entry Name
FBX9_HUMAN

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates at least 3 transcript variants diverging at the 5' terminus. [provided by RefSeq, Jul 2008]

Uniprot Description

FBXO9: Substrate-recognition component of the SCF (SKP1-CUL1-F- box protein)-type E3 ubiquitin ligase complex. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Ligase

Chromosomal Location of Human Ortholog: 6p12.3-p11.2

Cellular Component: cytoplasm; SCF ubiquitin ligase complex; ubiquitin ligase complex

Molecular Function: protein binding; ubiquitin-protein ligase activity

Biological Process: fat cell differentiation; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; innate immune response; protein ubiquitination; regulation of TOR signaling pathway

Research Articles on FBXO9

Similar Products

Product Notes

The FBXO9 fbxo9 (Catalog #AAA6136572) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXO9 (FBX9, VCIA1, F-box Only Protein 9, Cross-immune Reaction Antigen 1, Renal Carcinoma Antigen NY-REN-57, dJ341E18.2, DKFZp434C0118, KIAA0936) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXO9 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBXO9 fbxo9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXO9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.