Mouse anti-Human FBXO22 Monoclonal Antibody | anti-FBXO22 antibody

FBXO22 (F-box Only Protein 22, F-box Protein 22, FBX22, F-box Protein FBX22p44, FIST Domain Containing 1, FISTC1, FLJ13986, MGC31799) APC

Cat. Num. AAA6136559

• Gene Names: FBXO22; FBX22; FISTC1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FBXO22; Monoclonal Antibody; FBXO22 (F-box Only Protein 22; F-box Protein 22; FBX22; F-box Protein FBX22p44; FIST Domain Containing 1; FISTC1; FLJ13986; MGC31799) APC; anti-FBXO22 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 6G9
• Specificity: Recognizes human FBXO22.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
• Sequence Length: 2188

• Applicable Applications for anti-FBXO22 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-300 from human FBXO22 (AAH39024) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MADSETFISLEECRGHKRARKRTSMETALALEKLFPKQCQVLGIVTPGIVVTPMGSGSNRPQEIEIGESGFALLFPQIEGIKIQPFHFIKDPKNLTLERHQLTEVGLLDNPELRVVLVFGYNCCKVGASNYLQQVVSTFSDMNIILAGGQVDNLSSLTSEKNPLDIDASGVVGLSFSGHRIQSATVLLNEDVSDEKTAEAAMQRLKAANIPEHNTIGFMFACVGRGFQYYRAKGNVEADAFRKFFPSVPLFGFFG
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (59kD).)

Western Blot (WB)

(FBXO22 monoclonal antibody. Western Blot analysis of FBXO22 expression in Hela NE.)

Testing Data

(Detection limit for recombinant GST tagged FBXO22 is ~0.3ng/ml as a capture antibody.)

Product Categories/Family for anti-FBXO22 antibody

Antibodies; Ubiquitin Ligases

NCBI and Uniprot Product Information

• NCBI GI #: 24659488
• NCBI GeneID: 26263
• NCBI Official Full Name: Homo sapiens F-box protein 22, mRNA
• NCBI Official Synonym Full Names: F-box protein 22
• NCBI Official Symbol: FBXO22
• NCBI Official Synonym Symbols: FBX22; FISTC1
• NCBI Protein Information: F-box only protein 22
• Protein Family: F-box only protein

NCBI Description

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and, as a transcriptional target of the tumor protein p53, is thought to be involved in degradation of specific proteins in response to p53 induction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2010]