Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human FBXL3 Monoclonal Antibody | anti-FBXL3 antibody

FBXL3 (F-box/LRR-repeat Protein 3, F-box and Leucine-rich Repeat Protein 3A, F-box/LRR-repeat Protein 3A, FBL3A, FBXL3A) (MaxLight 405)

Gene Names
FBXL3; FBL3; FBL3A; FBXL3A
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FBXL3; Monoclonal Antibody; FBXL3 (F-box/LRR-repeat Protein 3; F-box and Leucine-rich Repeat Protein 3A; F-box/LRR-repeat Protein 3A; FBL3A; FBXL3A) (MaxLight 405); anti-FBXL3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C4
Specificity
Recognizes human FBXL3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-FBXL3 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human DFBXL3 (NP_036290) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHASQVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIK*
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-FBXL3 antibody
MaxLight405 is a new Violet photostable dye conjugate comparable to Alexa Fluor 405, PacificBlue, Brilliant Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (400nm); Emission (423nm); Extinction Coefficient 32,000.
Product Categories/Family for anti-FBXL3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,707 Da
NCBI Official Full Name
F-box/LRR-repeat protein 3
NCBI Official Synonym Full Names
F-box and leucine-rich repeat protein 3
NCBI Official Symbol
FBXL3
NCBI Official Synonym Symbols
FBL3; FBL3A; FBXL3A
NCBI Protein Information
F-box/LRR-repeat protein 3; F-box and leucine-rich repeat protein 3A; F-box protein Fbl3a; F-box/LRR-repeat protein 3A
UniProt Protein Name
F-box/LRR-repeat protein 3
UniProt Gene Name
FBXL3
UniProt Synonym Gene Names
FBL3A; FBXL3A
UniProt Entry Name
FBXL3_HUMAN

Uniprot Description

FBXL3: Substrate-recognition component of some SCF (SKP1-CUL1- F-box protein)-type E3 ubiquitin ligase complex involved in circadian clock function. The SCF(FBXL3) complex acts by mediating ubiquitination and subsequent degradation of CRY1 and CRY2. Recruiter of target protein that may recognize and bind to some phosphorylated proteins and promotes their ubiquitination and degradation.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 13q22

Cellular Component: nucleoplasm; cytoplasm; SCF ubiquitin ligase complex; cytosol; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; ubiquitin-protein ligase activity

Biological Process: circadian rhythm; SCF-dependent proteasomal ubiquitin-dependent protein catabolic process; protein destabilization; protein ubiquitination; regulation of circadian rhythm; entrainment of circadian clock by photoperiod

Similar Products

Product Notes

The FBXL3 fbxl3 (Catalog #AAA6190114) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXL3 (F-box/LRR-repeat Protein 3, F-box and Leucine-rich Repeat Protein 3A, F-box/LRR-repeat Protein 3A, FBL3A, FBXL3A) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXL3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBXL3 fbxl3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXL3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.