Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human FBXL21 Monoclonal Antibody | anti-FBXL21 antibody

FBXL21 (F-box/LRR-repeat Protein 21, F-box and Leucine-rich repeat Protein 21, F-box and Leucine-rich Repeat Protein 3B, F-box/LRR-repeat Protein 3B, FBL21, FBL3, FBXL3B, FBXL3P) (MaxLight 650)

Gene Names
FBXL21P; FBL3B; Fbl21; FBXL21; FBXL3B; FBXL3P
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FBXL21; Monoclonal Antibody; FBXL21 (F-box/LRR-repeat Protein 21; F-box and Leucine-rich repeat Protein 21; F-box and Leucine-rich Repeat Protein 3B; F-box/LRR-repeat Protein 3B; FBL21; FBL3; FBXL3B; FBXL3P) (MaxLight 650); anti-FBXL21 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A1
Specificity
Recognizes human FBXL21.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-FBXL21 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa167-277 from human FBXL21 (NP_036291) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VSKVVLGRVGLNCPRLIELVVCANDLQPLDNELICIAEHCTNLTALGLSKCEVSCSAFIRFVRLCERRLTQLSVMEEVLIPDEDYSLDEIHTEVSKYLGRVWFPDVMPLW*
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-FBXL21 antibody
Substrate-recognition component of some SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex involved in circadian pacemaker function. The SCF(FBXL21) complex acts by mediating ubiquitination and subsequent degradation of CRY1. Probable clock-controlled protein that plays a specific role in suprachiasmatic nucleus, SCN and pacemaker function.
Product Categories/Family for anti-FBXL21 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Synonym Full Names
F-box and leucine rich repeat protein 21, pseudogene
NCBI Official Symbol
FBXL21P
NCBI Official Synonym Symbols
FBL3B; Fbl21; FBXL21; FBXL3B; FBXL3P
UniProt Protein Name
F-box/LRR-repeat protein 21
Protein Family
UniProt Gene Name
FBXL21
UniProt Synonym Gene Names
FBL21; FBL3; FBXL3B; FBXL3P
UniProt Entry Name
FXL21_HUMAN

NCBI Description

This locus represents a transcribed pseudogene that is related to genes encoding members of the F-box family of proteins. [provided by RefSeq, Nov 2017]

Uniprot Description

FBXL21: Substrate-recognition component of some SCF (SKP1-CUL1- F-box protein)-type E3 ubiquitin ligase complex involved in circadian pacemaker function. The SCF(FBXL21) complex acts by mediating ubiquitination and subsequent degradation of CRY1. Probable clock-controlled protein that plays a specific role in suprachiasmatic nucleus, SCN and pacemaker function.

Chromosomal Location of Human Ortholog: 5q31

Cellular Component: SCF ubiquitin ligase complex; cytosol; nucleus; ubiquitin ligase complex

Molecular Function: ubiquitin-protein ligase activity

Biological Process: rhythmic process; protein ubiquitination; entrainment of circadian clock by photoperiod

Research Articles on FBXL21

Similar Products

Product Notes

The FBXL21 fbxl21 (Catalog #AAA6222138) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FBXL21 (F-box/LRR-repeat Protein 21, F-box and Leucine-rich repeat Protein 21, F-box and Leucine-rich Repeat Protein 3B, F-box/LRR-repeat Protein 3B, FBL21, FBL3, FBXL3B, FBXL3P) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FBXL21 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FBXL21 fbxl21 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FBXL21, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.