Mouse anti-Human FARSB Monoclonal Antibody | anti-FARSB antibody

FARSB (Phenylalanine-tRNA Ligase beta Subunit, Phenylalanyl-tRNA Synthetase beta Subunit, PheRS, FARSLB, FRSB, HSPC173) (PE)

Cat. Num. AAA6157752

• Gene Names: FARSB; FRSB; PheHB; PheRS; FARSLB; RILDBC; HSPC173; NEDBLLA
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FARSB; Monoclonal Antibody; FARSB (Phenylalanine-tRNA Ligase beta Subunit; Phenylalanyl-tRNA Synthetase beta Subunit; PheRS; FARSLB; FRSB; HSPC173) (PE); anti-FARSB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2F11
• Specificity: Recognizes human FARSLB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 6761

• Applicable Applications for anti-FARSB antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa234-341 from FARSLB (NP_005678) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PPIINGDHSRITVNTRNIFIECTGTDFTKAKIVLDIIVTMFSEYCENQFTVEAAEVVFPNGKSHTFPELAYRKEMVRADLINKKVGIRETPENLAKLLTRMYLKSEVI
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB)

(FARSLB monoclonal antibody Western Blot analysis of FARSLB expression in HepG2)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FARSLB on formalin-fixed paraffin-embedded human tonsil tissue. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FARSLB on formalin-fixed paraffin-embedded human cerebellum. [antibody concentration 3ug/ml])

Product Categories/Family for anti-FARSB antibody

Antibodies; DNA/RNA Translation

NCBI and Uniprot Product Information

• NCBI GI #: 1653962232
• NCBI GeneID: 10056
• NCBI Accession #: NM_005687.5
• NCBI GenBank Nucleotide #: NM_005687
• NCBI Official Full Name: Homo sapiens phenylalanyl-tRNA synthetase subunit beta (FARSB), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: phenylalanyl-tRNA synthetase subunit beta
• NCBI Official Symbol: FARSB
• NCBI Official Synonym Symbols: FRSB; PheHB; PheRS; FARSLB; RILDBC; HSPC173; NEDBLLA
• NCBI Protein Information: phenylalanine--tRNA ligase beta subunit

NCBI Description

This gene encodes a highly conserved enzyme that belongs to the aminoacyl-tRNA synthetase class IIc subfamily. This enzyme comprises the regulatory beta subunits that form a tetramer with two catalytic alpha subunits. In the presence of ATP, this tetramer is responsible for attaching L-phenylalanine to the terminal adenosine of the appropriate tRNA. A pseudogene located on chromosome 10 has been identified. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2015]