Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human FADS1 Monoclonal Antibody | anti-FADS1 antibody

FADS1 (Fatty Acid Desaturase 1, Delta(5) Fatty Acid Desaturase, D5D, Delta(5) Desaturase, Delta-5 Desaturase, FADSD5, FLJ38956, FLJ90273) (PE)

Gene Names
FADS1; D5D; TU12; FADS6; FADSD5; LLCDL1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FADS1; Monoclonal Antibody; FADS1 (Fatty Acid Desaturase 1; Delta(5) Fatty Acid Desaturase; D5D; Delta(5) Desaturase; Delta-5 Desaturase; FADSD5; FLJ38956; FLJ90273) (PE); anti-FADS1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D9
Specificity
Recognizes human FADS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-FADS1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-99 from human FADS1 (NP_037534) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAPDPVAAETAAQGPTPRYFTWDEVAQRSGCEERWLVIDRKVYNISEFTRRHPGGSRVISHYAGQDATDPFVAFHINKGLVKKYMNSLLIGELSPEQPS
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB)

(FADS1 monoclonal antibody. Western Blot analysis of expression in Hela NE.)

Western Blot (WB) (FADS1 monoclonal antibody. Western Blot analysis of expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FADS1 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to FADS1 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged FADS1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FADS1 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-FADS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
42,474 Da
NCBI Official Full Name
fatty acid desaturase 1
NCBI Official Synonym Full Names
fatty acid desaturase 1
NCBI Official Symbol
FADS1
NCBI Official Synonym Symbols
D5D; TU12; FADS6; FADSD5; LLCDL1
NCBI Protein Information
fatty acid desaturase 1; delta(5) desaturase; delta(5) fatty acid desaturase; delta-5 desaturase; delta-5 fatty acid desaturase; linoleoyl-CoA desaturase (delta-6-desaturase)-like 1
UniProt Protein Name
Fatty acid desaturase 1
Protein Family
UniProt Gene Name
FADS1
UniProt Synonym Gene Names
FADSD5; D5D; Delta(5) desaturase; Delta-5 desaturase
UniProt Entry Name
FADS1_HUMAN

Uniprot Description

FADS1: Component of a lipid metabolic pathway that catalyzes biosynthesis of highly unsaturated fatty acids (HUFA) from precursor essential polyunsaturated fatty acids (PUFA) linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Catalyzes the desaturation of dihomo-gamma-linoleic acid (DHGLA) (20:3n-6) and eicosatetraenoic acid (20:4n-3) to generate arachidonic acid (AA) (20:4n-6) and eicosapentaenoic acid (EPA)(20:5n-3) respectively. Belongs to the fatty acid desaturase family.

Protein type: EC 1.14.19.-; Membrane protein, multi-pass; Oxidoreductase; Lipid Metabolism - unsaturated fatty acid biosynthesis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q12.2-q13.1

Cellular Component: endoplasmic reticulum membrane; intracellular membrane-bound organelle; mitochondrion; membrane; integral to membrane

Molecular Function: C-5 sterol desaturase activity; iron ion binding; heme binding; oxidoreductase activity

Biological Process: icosanoid biosynthetic process; regulation of transcription, DNA-dependent; cell-cell signaling; regulation of cell differentiation; unsaturated fatty acid metabolic process; linoleic acid metabolic process; unsaturated fatty acid biosynthetic process; cellular lipid metabolic process; cellular response to starvation; phospholipid biosynthetic process

Similar Products

Product Notes

The FADS1 fads1 (Catalog #AAA6157734) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FADS1 (Fatty Acid Desaturase 1, Delta(5) Fatty Acid Desaturase, D5D, Delta(5) Desaturase, Delta-5 Desaturase, FADSD5, FLJ38956, FLJ90273) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FADS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FADS1 fads1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FADS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.