Mouse anti-Human FABP3 Monoclonal Antibody | anti-FABP3 antibody

FABP3 (Fatty Acid-binding Protein, Heart, Heart-type Fatty Acid-binding Protein, H-FABP, Fatty Acid-binding Protein 3, Muscle Fatty Acid-binding Protein, M-FABP, Mammary-derived Growth Inhibitor, MDGI, FABP11) (AP)

Cat. Num. AAA6131214

• Gene Names: FABP3; MDGI; FABP11; H-FABP; M-FABP; O-FABP
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FABP3; Monoclonal Antibody; FABP3 (Fatty Acid-binding Protein; Heart; Heart-type Fatty Acid-binding Protein; H-FABP; Fatty Acid-binding Protein 3; Muscle Fatty Acid-binding Protein; M-FABP; Mammary-derived Growth Inhibitor; MDGI; FABP11) (AP); anti-FABP3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F6-1D6
• Specificity: Recognizes human FABP3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-FABP3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant protein corresponding to aa1-133 from human FABP3 (BC007021; AAH07021) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (40.37kD).)

Western Blot (WB)

(Western Blot analysis of FABP3 expression in transfected 293T cell line by FABP3 monoclonal antibody. Lane 1: FABP3 transfected lysate (14.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged FABP3 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of FABP3 over-expressed 293 cell line, cotransfected with FABP3 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with FABP3 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Related Product Information for anti-FABP3 antibody

The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15kD proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells.

Product Categories/Family for anti-FABP3 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13937836
• NCBI GeneID: 2170
• Molecular Weight: 14,858 Da
• NCBI Official Full Name: Homo sapiens fatty acid binding protein 3, muscle and heart (mammary-derived growth inhibitor), mRNA
• NCBI Official Synonym Full Names: fatty acid binding protein 3, muscle and heart
• NCBI Official Symbol: FABP3
• NCBI Official Synonym Symbols: MDGI; FABP11; H-FABP; M-FABP; O-FABP
• NCBI Protein Information: fatty acid-binding protein, heart; Fatty acid-binding protein 3, muscle; fatty acid binding protein 11; heart-type fatty acid-binding protein; mammary-derived growth inhibitor; muscle fatty acid-binding protein
• Protein Family: Fatty acid-binding protein

NCBI Description

The intracellular fatty acid-binding proteins (FABPs) belongs to a multigene family. FABPs are divided into at least three distinct types, namely the hepatic-, intestinal- and cardiac-type. They form 14-15 kDa proteins and are thought to participate in the uptake, intracellular metabolism and/or transport of long-chain fatty acids. They may also be responsible in the modulation of cell growth and proliferation. Fatty acid-binding protein 3 gene contains four exons and its function is to arrest growth of mammary epithelial cells. This gene is a candidate tumor suppressor gene for human breast cancer. [provided by RefSeq, Jul 2008]