Testing Data
(Detection limit for recombinant GST tagged FABP2 is 0.3ng/ml as a capture antibody.)
Mouse anti-Human FABP2 Monoclonal Antibody | anti-FABP2 antibody
FABP2 (Fatty Acid-binding Protein, Intestinal, Fatty Acid-binding Protein 2, Intestinal-type Fatty Acid-binding Protein, I-FABP, FABPI) (FITC)
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FABP2; Monoclonal Antibody; FABP2 (Fatty Acid-binding Protein; Intestinal; Fatty Acid-binding Protein 2; Intestinal-type Fatty Acid-binding Protein; I-FABP; FABPI) (FITC); anti-FABP2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2F7
Specificity
Recognizes human FABP2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
132
Applicable Applications for anti-FABP2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-90 from human FABP2 (NP_000125.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged FABP2 is 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged FABP2 is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-FABP2 antibody
FABP2, also known as intestinal fatty acid binding protein 2 (I-FABP), is expressed in the epithelium of the small intestine by mature enterocytes. FABP2 is thought to facilitate of cellular uptake and transport of long-chain fatty acids within enterocytes and may also help maintain energy homeostasis by functioning as a lipid sensor. This protein binds saturated long-chain fatty acid with a high affinity, but binds with a low affinity to unsaturated long-chain fatty acid. The Ala to Thr substitution at residue 54 of FABP2 is associated with higher total cholesterol, with stroke incidence, elevation of fasting and postprandial triglyceride, insulin resistance, and higher nonesterified fatty acid (NEFA) concentrations.
Product Categories/Family for anti-FABP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
intestinal fatty acid binding protein 2
Protein Family
Similar Products
Product Notes
The FABP2 (Catalog #AAA6147122) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FABP2 (Fatty Acid-binding Protein, Intestinal, Fatty Acid-binding Protein 2, Intestinal-type Fatty Acid-binding Protein, I-FABP, FABPI) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FABP2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FABP2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FABP2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
