Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.19kD).)

Mouse anti-Human F9 Monoclonal Antibody | anti-F9 antibody

F9 (Coagulation Factor IX, Christmas Factor, Plasma Thromboplastin Component, PTC) APC

Gene Names
F9; FIX; P19; PTC; HEMB; THPH8
Reactivity
Human
Applications
Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
F9; Monoclonal Antibody; F9 (Coagulation Factor IX; Christmas Factor; Plasma Thromboplastin Component; PTC) APC; anti-F9 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C9
Specificity
Recognizes human F9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-F9 antibody
FLISA, Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa96-190 from human F9 (NP_000124) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLT
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.19kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.19kD).)

Western Blot (WB)

(Western Blot analysis of F9 expression in transfected 293T cell line by MBS6011342 Lane 1: F9 transfected lysate (51.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of F9 expression in transfected 293T cell line by MBS6011342 Lane 1: F9 transfected lysate (51.8kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of F9 transfected lysate using MBS6011342 and Protein A Magnetic Bead and immunoblotted with F9 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of F9 transfected lysate using MBS6011342 and Protein A Magnetic Bead and immunoblotted with F9 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged F9 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged F9 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(Western blot analysis of F9 over-expressed 293 cell line, cotransfected with F9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed withMBS6011342. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of F9 over-expressed 293 cell line, cotransfected with F9 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed withMBS6011342. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-F9 antibody
Coagulation Factor IX (F9) circulates in the blood as an inactive zymogen. This factor is converted to an active form by factor XIa, which excises the activation peptide and thus generates a heavy chain and a light chain held together by one or more disulfide bonds. The role of this activated factor IX in the blood coagulation cascade is to activate factor X to its active form through interactions with Ca+2 ions, membrane phospholipids, and factor VIII. Alterations of this gene, including point mutations, insertions and deletions, cause factor IX deficiency, which is a recessive X-linked disorder, also called hemophilia B or Christmas disease.
Product Categories/Family for anti-F9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47,618 Da
NCBI Official Full Name
coagulation factor IX preproprotein
NCBI Official Synonym Full Names
coagulation factor IX
NCBI Official Symbol
F9
NCBI Official Synonym Symbols
FIX; P19; PTC; HEMB; THPH8
NCBI Protein Information
coagulation factor IX; Christmas factor; F9 p22; FIX F9; factor 9; factor IX F9; plasma thromboplastic component; plasma thromboplastin component
UniProt Protein Name
Coagulation factor IX
Protein Family
UniProt Gene Name
F9
UniProt Synonym Gene Names
PTC
UniProt Entry Name
FA9_HUMAN

Uniprot Description

F9: Factor IX is a vitamin K-dependent plasma protein that participates in the intrinsic pathway of blood coagulation by converting factor X to its active form in the presence of Ca(2+) ions, phospholipids, and factor VIIIa. Defects in F9 are the cause of recessive X-linked hemophilia B (HEMB); also known as Christmas disease. Mutations in position 43 (Oxford-3, San Dimas) and 46 (Cambridge) prevents cleavage of the propeptide, mutation in position 93 (Alabama) probably fails to bind to cell membranes, mutation in position 191 (Chapel-Hill) or in position 226 (Nagoya OR Hilo) prevent cleavage of the activation peptide. Defects in F9 are the cause of thrombophilia due to factor IX defect (THPH8). A hemostatic disorder characterized by a tendency to thrombosis. Belongs to the peptidase S1 family.

Protein type: Secreted; Protease; Secreted, signal peptide; EC 3.4.21.22

Chromosomal Location of Human Ortholog: Xq27.1-q27.2

Cellular Component: Golgi lumen; endoplasmic reticulum lumen; plasma membrane; extracellular region

Molecular Function: serine-type endopeptidase activity; calcium ion binding

Biological Process: blood coagulation, extrinsic pathway; cellular protein metabolic process; post-translational protein modification; blood coagulation; proteolysis; peptidyl-glutamic acid carboxylation; blood coagulation, intrinsic pathway

Disease: Hemophilia B; Thrombophilia, X-linked, Due To Factor Ix Defect; Coumarin Resistance

Similar Products

Product Notes

The F9 f9 (Catalog #AAA6136514) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The F9 (Coagulation Factor IX, Christmas Factor, Plasma Thromboplastin Component, PTC) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's F9 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the F9 f9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "F9, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.