Mouse anti-Human EXOSC5 Monoclonal Antibody | anti-EXOSC5 antibody

EXOSC5 (Exosome Complex Component RRP46, Chronic Myelogenous Leukemia Tumor Antigen 28, Exosome Component 5, Ribosomal RNA-processing Protein 46, p12B, CML28, RRP46, MGC111224, MGC12901) (HRP)

Cat. Num. AAA6152411

• Gene Names: EXOSC5; p12B; RRP46; RRP41B; Rrp46p; hRrp46p
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EXOSC5; Monoclonal Antibody; EXOSC5 (Exosome Complex Component RRP46; Chronic Myelogenous Leukemia Tumor Antigen 28; Exosome Component 5; Ribosomal RNA-processing Protein 46; p12B; CML28; RRP46; MGC111224; MGC12901) (HRP); anti-EXOSC5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1E11
• Specificity: Recognizes human EXOSC5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-EXOSC5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from human EXOSC5 (NP_064543) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYGPAEVKVSKEIFNKATLEVILRPKIGLPGVAEKSRERLIRN
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of EXOSC5 expression in transfected 293T cell line by EXOSC5 monoclonal antibody. Lane 1: EXOSC5 transfected lysate (25.3kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged EXOSC5 is 3ng/ml as a capture antibody.)

Related Product Information for anti-EXOSC5 antibody

Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes.

Product Categories/Family for anti-EXOSC5 antibody

Antibodies; Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 47174864
• NCBI GeneID: 56915
• NCBI Accession #: NP_064543.3
• NCBI GenBank Nucleotide #: NM_020158
• UniProt Accession #: Q9NQT4; Q32Q81; Q8NG16; Q96I89
• Molecular Weight: 25,249 Da
• NCBI Official Full Name: exosome complex component RRP46
• NCBI Official Synonym Full Names: exosome component 5
• NCBI Official Symbol: EXOSC5
• NCBI Official Synonym Symbols: p12B; RRP46; RRP41B; Rrp46p; hRrp46p
• NCBI Protein Information: exosome complex component RRP46; chronic myelogenous leukemia tumor antigen 28; exosome complex exonuclease RRP46; exosome component Rrp46; ribosomal RNA-processing protein 46
• UniProt Protein Name: Exosome complex component RRP46
• Protein Family: Exosome complex component
• UniProt Gene Name: EXOSC5
• UniProt Synonym Gene Names: CML28; RRP46
• UniProt Entry Name: EXOS5_HUMAN

Uniprot Description

EXOSC5: Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. Belongs to the RNase PH family.

Protein type: Ribonuclease; Nucleolus; EC 3.1.13.-

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: cytoplasm; nucleolus; exosome (RNase complex); nucleus; cytosol

Molecular Function: protein binding; 3'-5'-exoribonuclease activity; exoribonuclease activity; RNA binding

Biological Process: gene expression; DNA deamination; defense response to virus; rRNA processing; mRNA catabolic process, deadenylation-dependent decay