Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse EXOSC4 Monoclonal Antibody | anti-EXOSC4 antibody

EXOSC4 (exosome Component 4, FLJ20591, RRP41, RRP41A, Rrp41p, SKI6, Ski6p, hRrp41p, p12A) (MaxLight 550)

Gene Names
EXOSC4; SKI6; p12A; RRP41; Ski6p; RRP41A; Rrp41p; hRrp41p
Applications
Western Blot
Purity
Purified
Synonyms
EXOSC4; Monoclonal Antibody; EXOSC4 (exosome Component 4; FLJ20591; RRP41; RRP41A; Rrp41p; SKI6; Ski6p; hRrp41p; p12A) (MaxLight 550); exosome Component 4; p12A; anti-EXOSC4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F9
Specificity
Recognizes EXOSC4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-EXOSC4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EXOSC4 (NP_061910.1, 1aa-100aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMG
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-EXOSC4 antibody
Mouse monoclonal antibody raised against a partial recombinant EXOSC4.
Product Categories/Family for anti-EXOSC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,383 Da
NCBI Official Full Name
exosome complex component RRP41
NCBI Official Synonym Full Names
exosome component 4
NCBI Official Symbol
EXOSC4
NCBI Official Synonym Symbols
SKI6; p12A; RRP41; Ski6p; RRP41A; Rrp41p; hRrp41p
NCBI Protein Information
exosome complex component RRP41; exosome complex exonuclease RRP41; exosome component Rrp41; ribosomal RNA-processing protein 41
UniProt Protein Name
Exosome complex component RRP41
UniProt Gene Name
EXOSC4
UniProt Synonym Gene Names
RRP41; SKI6
UniProt Entry Name
EXOS4_HUMAN

Uniprot Description

EXOSC4: Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC4 binds to ARE-containing RNAs. Belongs to the RNase PH family.

Protein type: Nucleolus; EC 3.1.13.-; Ribonuclease

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: cytoplasm; nucleolus; exosome (RNase complex); cytosol; nucleus

Molecular Function: protein binding; 3'-5'-exoribonuclease activity; exoribonuclease activity; AU-rich element binding

Biological Process: maturation of 5.8S rRNA; gene expression; DNA deamination; defense response to virus; positive regulation of cell growth; rRNA processing; mRNA catabolic process, deadenylation-dependent decay

Research Articles on EXOSC4

Similar Products

Product Notes

The EXOSC4 exosc4 (Catalog #AAA6216766) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EXOSC4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EXOSC4 exosc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EXOSC4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.