Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD))

Mouse anti-Human EXOSC4 Monoclonal Antibody | anti-EXOSC4 antibody

EXOSC4 (RRP41, SKI6, Exosome Complex Component RRP41, Exosome Component 4, Ribosomal RNA-processing Protein 41, p12A, FLJ20591, RRP41A, Rrp41p, SKI6, Ski6p, HRrp41p)

Gene Names
EXOSC4; RRP41
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
EXOSC4; Monoclonal Antibody; EXOSC4 (RRP41; SKI6; Exosome Complex Component RRP41; Exosome Component 4; Ribosomal RNA-processing Protein 41; p12A; FLJ20591; RRP41A; Rrp41p; Ski6p; HRrp41p); Anti -EXOSC4 (RRP41; anti-EXOSC4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4F10
Specificity
Recognizes human EXOSC4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAGLELLSDQGYRVDGRRAGELRKIQARMGVFAQADGSAYIEQGNTKALAVVYGPHEIRGSRARALPDRALVNCQYSSATFSTGERKRRPHGDRKSCEMG
Applicable Applications for anti-EXOSC4 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1-101 from human EXOSC4 (NP_061910) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD))

Western Blot (WB) (Western Blot detection against Immunogen (37kD))

Western Blot (WB)

(Western Blot analysis of EXOSC4 expression in transfected 293T cell line by EXOSC4 monoclonal antibody.|Lane 1: EXOSC4 transfected lysate (26.4kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EXOSC4 expression in transfected 293T cell line by EXOSC4 monoclonal antibody.|Lane 1: EXOSC4 transfected lysate (26.4kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged EXOSC4 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EXOSC4 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-EXOSC4 antibody
Component of the exosome 3'->5' exoribonuclease complex, a complex that degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3'-untranslated regions. Required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA. Has a 3'-5' exonuclease activity. Plays a role in replication-dependent histone mRNA degradation.
Product Categories/Family for anti-EXOSC4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,343 Da
NCBI Official Full Name
exosome complex component RRP41
NCBI Official Synonym Full Names
exosome component 4
NCBI Official Symbol
EXOSC4
NCBI Official Synonym Symbols
RRP41
NCBI Protein Information
exosome complex component RRP41; exosome complex exonuclease RRP41; ribosomal RNA processing protein 41; ribosomal RNA-processing protein 41
UniProt Protein Name
Exosome complex component RRP41
UniProt Gene Name
EXOSC4
UniProt Synonym Gene Names
RRP41
UniProt Entry Name
EXOS4_BOVIN

Uniprot Description

Function: Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. EXOSC4 binds to ARE-containing RNAs

By similarity.

Subunit structure: Component of the RNA exosome complex. Specifically part of the catalytically inactive RNA exosome core (Exo-9) complex which is believed to associate with catalytic subunits EXOSC10, and DIS3 or DIS3L in cytoplasmic- and nuclear-specific RNA exosome complex forms. Exo-9 is formed by a hexameric ring of RNase PH domain-containing subunits specifically containing the heterodimers EXOSC4-EXOSC9, EXOSC5-EXOSC8 and EXOSC6-EXOSC7, and peripheral S1 domain-containing components EXOSC1, EXOSC2 and EXOSC3 located on the top of the ring structure

By similarity. Interacts with DDX60

By similarity.

Subcellular location: Cytoplasm

By similarity. Nucleus › nucleolus

By similarity. Nucleus

By similarity.

Sequence similarities: Belongs to the RNase PH family.

Similar Products

Product Notes

The EXOSC4 exosc4 (Catalog #AAA648046) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EXOSC4 (RRP41, SKI6, Exosome Complex Component RRP41, Exosome Component 4, Ribosomal RNA-processing Protein 41, p12A, FLJ20591, RRP41A, Rrp41p, SKI6, Ski6p, HRrp41p) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EXOSC4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the EXOSC4 exosc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGLELLSDQ GYRVDGRRAG ELRKIQARMG VFAQADGSAY IEQGNTKALA VVYGPHEIRG SRARALPDRA LVNCQYSSAT FSTGERKRRP HGDRKSCEMG. It is sometimes possible for the material contained within the vial of "EXOSC4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.