Western Blot (WB)
(Western Blot detection against Immunogen (36.63kD).)
Mouse anti-Human ETS1 Monoclonal Antibody | anti-ETS1 antibody
ETS1 (Protein C-ets-1, p54, EWSR2) (FITC)
Gene Names
ETS1; p54; ETS-1; EWSR2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ETS1; Monoclonal Antibody; ETS1 (Protein C-ets-1; p54; EWSR2) (FITC); anti-ETS1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2G10
Specificity
Recognizes human ETS1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-ETS1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Sandwich ELISA: The detection limit is 1ng/ml as a capture antibody
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa173-272 from human ETS1 (AAH17314.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.63kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.63kD).)
Testing Data
(Detection limit for recombinant GST tagged ETS1 is 1ng/ml as a capture antibody)
Testing Data
(Detection limit for recombinant GST tagged ETS1 is 1ng/ml as a capture antibody)
Product Categories/Family for anti-ETS1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
30,860 Da
NCBI Official Full Name
Homo sapiens v-ets erythroblastosis virus E26 oncogene homolog 1 (avian), mRNA
NCBI Official Synonym Full Names
v-ets avian erythroblastosis virus E26 oncogene homolog 1
NCBI Official Symbol
ETS1
NCBI Official Synonym Symbols
p54; ETS-1; EWSR2
NCBI Protein Information
protein C-ets-1; Avian erythroblastosis virus E26 (v-ets) oncogene homolog-1; v-ets avian erythroblastosis virus E2 oncogene homolog 1
Protein Family
NCBI Description
This gene encodes a member of the ETS family of transcription factors, which are defined by the presence of a conserved ETS DNA-binding domain that recognizes the core consensus DNA sequence GGAA/T in target genes. These proteins function either as transcriptional activators or repressors of numerous genes, and are involved in stem cell development, cell senescence and death, and tumorigenesis. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.[provided by RefSeq, Jul 2011]
Research Articles on ETS1
Similar Products
Product Notes
The ETS1 (Catalog #AAA6147089) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ETS1 (Protein C-ets-1, p54, EWSR2) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ETS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Sandwich ELISA: The detection limit is 1ng/ml as a capture antibody Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ETS1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ETS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
