Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ESAM is 0.3ng/ml as a capture antibody.)

Mouse anti-Human ESAM Monoclonal Antibody | anti-ESAM antibody

ESAM (Endothelial Cell-selective Adhesion Molecule, UNQ220/PRO246, W117m)

Gene Names
ESAM; W117m
Reactivity
Human
Applications
ELISA
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ESAM; Monoclonal Antibody; ESAM (Endothelial Cell-selective Adhesion Molecule; UNQ220/PRO246; W117m); Anti -ESAM (Endothelial Cell-selective Adhesion Molecule; anti-ESAM antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1G8
Specificity
Recognizes human ESAM.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MISLPGPLVTNLLRFLFLGLSALAPPSRAQLQLHLPANRLQAVEGGEVVLPAWYTLHGEVSSSQPWEVPFVMWFFKQKEKEDQVLSYINGVTTSKPGVSLVYSMPSRNLSLRLEGLQEKDSGPYSCSVNVQDKQGKSRGHSIKTLELNVLVPPAPPSCRLQGVPHVGANVTLSCQSPRSKPAVQYQWDRQLPSFQTFFAPALDVIRGSLSLTNLSSSMAGVYVCKAHNEVGTAQCNVTLEVSTGPGAAVVAGAVVGTLVGLGLLAGLVLLYHRRGKALEEPANDIKEDAIAPRTLPWPKSSDTISKNGTLSSVTSARALRPPHGPPRPGALTPTPSLSSQALPSPRLPTTDGAHPQPISPIPGGVSSSGLSRMGAVPVMVPAQSQAGSLV
Applicable Applications for anti-ESAM antibody
ELISA (EL/EIA)
Application Notes
Suitable for use in ELISA.
Immunogen
Full length recombinant protein corresponding to aa1-391 from human ESAM (AAH16868) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ESAM is 0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ESAM is 0.3ng/ml as a capture antibody.)
Related Product Information for anti-ESAM antibody
Can mediate aggregation most likely through a homophilic molecular interaction.
Product Categories/Family for anti-ESAM antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41,176 Da
NCBI Official Full Name
endothelial cell-selective adhesion molecule
NCBI Official Synonym Full Names
endothelial cell adhesion molecule
NCBI Official Symbol
ESAM
NCBI Official Synonym Symbols
W117m
NCBI Protein Information
endothelial cell-selective adhesion molecule; 2310008D05Rik; LP4791 protein; HUEL (C4orf1)-interacting protein
UniProt Protein Name
Endothelial cell-selective adhesion molecule
UniProt Gene Name
ESAM
UniProt Entry Name
ESAM_HUMAN

Uniprot Description

ESAM: Can mediate aggregation most likely through a homophilic molecular interaction.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 11q24.2

Cellular Component: tight junction; adherens junction; plasma membrane; integral to membrane

Biological Process: cell-cell adhesion; blood coagulation; homophilic cell adhesion; leukocyte migration

Research Articles on ESAM

Similar Products

Product Notes

The ESAM esam (Catalog #AAA6007556) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ESAM (Endothelial Cell-selective Adhesion Molecule, UNQ220/PRO246, W117m) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ESAM can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA). Suitable for use in ELISA. Researchers should empirically determine the suitability of the ESAM esam for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MISLPGPLVT NLLRFLFLGL SALAPPSRAQ LQLHLPANRL QAVEGGEVVL PAWYTLHGEV SSSQPWEVPF VMWFFKQKEK EDQVLSYING VTTSKPGVSL VYSMPSRNLS LRLEGLQEKD SGPYSCSVNV QDKQGKSRGH SIKTLELNVL VPPAPPSCRL QGVPHVGANV TLSCQSPRSK PAVQYQWDRQ LPSFQTFFAP ALDVIRGSLS LTNLSSSMAG VYVCKAHNEV GTAQCNVTLE VSTGPGAAVV AGAVVGTLVG LGLLAGLVLL YHRRGKALEE PANDIKEDAI APRTLPWPKS SDTISKNGTL SSVTSARALR PPHGPPRPGA LTPTPSLSSQ ALPSPRLPTT DGAHPQPISP IPGGVSSSGL SRMGAVPVMV PAQSQAGSLV. It is sometimes possible for the material contained within the vial of "ESAM, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.