Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse ERBB2 Monoclonal Antibody | anti-ERBB2 antibody

ERBB2 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 2, neuro/glioblastoma Derived Oncogene Homolog (avian), CD340, HER-2, HER-2/neu, HER2, NEU, NGL, TKR1) (MaxLight 490)

Gene Names
ERBB2; NEU; NGL; HER2; TKR1; CD340; HER-2; MLN 19; HER-2/neu
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
ERBB2; Monoclonal Antibody; ERBB2 (v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 2; neuro/glioblastoma Derived Oncogene Homolog (avian); CD340; HER-2; HER-2/neu; HER2; NEU; NGL; TKR1) (MaxLight 490); v-erb-b2 Erythroblastic Leukemia Viral Oncogene Homolog 2; TKR1; anti-ERBB2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4C10
Specificity
Recognizes ERBB2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-ERBB2 antibody
FLISA, Immunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay (Cell)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ERBB2 (NP_004439, 22aa-121aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
STQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNYALAVLDNGD
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ERBB2 antibody
This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. [provided by RefSeq]
Product Categories/Family for anti-ERBB2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
97,253 Da
NCBI Official Full Name
receptor tyrosine-protein kinase erbB-2 isoform a
NCBI Official Synonym Full Names
erb-b2 receptor tyrosine kinase 2
NCBI Official Symbol
ERBB2
NCBI Official Synonym Symbols
NEU; NGL; HER2; TKR1; CD340; HER-2; MLN 19; HER-2/neu
NCBI Protein Information
receptor tyrosine-protein kinase erbB-2; herstatin; p185erbB2; proto-oncogene Neu; c-erb B2/neu protein; proto-oncogene c-ErbB-2; metastatic lymph node gene 19 protein; human epidermal growth factor receptor 2; neuro/glioblastoma derived oncogene homolog;
UniProt Protein Name
Receptor tyrosine-protein kinase erbB-2
UniProt Gene Name
ERBB2
UniProt Synonym Gene Names
HER2; MLN19; NEU; NGL; MLN 19
UniProt Entry Name
ERBB2_HUMAN

NCBI Description

This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

HER2: a proto-oncogenic receptor tyrosine kinase of the EGFR family. Essential component of a neuregulin-receptor complex, although neuregulins do not interact with it alone. Not activated by EGF, TGF- alpha and amphiregulin. Amplified in breast cancer. Overexpression induces constitutive activity, and the gene is amplified or overexpressed in up to 30% of breast cancers, correlating with poor survival. The antibody Herceptin is approved for treatment of metastatic breast cancer with HER2 amplification/overexpression. Somatic mutations seen in 4% of lung cancers and also in breast, gastric, ovarian cancer and glioblastoma. One SNP shows predisposition to breast and gastric cancer. Inhibitors: Herceptin, lapatinib, PKI-166, EKB-569, CI-1033.

Protein type: Protein kinase, tyrosine (receptor); Kinase, protein; EC 2.7.10.1; Protein kinase, TK; Membrane protein, integral; Oncoprotein; TK group; EGFR family

Chromosomal Location of Human Ortholog: 17q12

Cellular Component: perinuclear region of cytoplasm; basolateral plasma membrane; cytoplasm; apical plasma membrane; integral to membrane; plasma membrane; endosome membrane; cytoplasmic vesicle; nucleus; receptor complex

Molecular Function: protein dimerization activity; protein C-terminus binding; identical protein binding; protein binding; transmembrane receptor activity; ErbB-3 class receptor binding; protein heterodimerization activity; protein-tyrosine kinase activity; growth factor binding; transmembrane receptor protein tyrosine kinase activity; receptor signaling protein tyrosine kinase activity; protein phosphatase binding; ATP binding

Biological Process: myelination; axon guidance; phosphoinositide 3-kinase cascade; peptidyl-tyrosine phosphorylation; positive regulation of cell adhesion; wound healing; nerve growth factor receptor signaling pathway; positive regulation of translation; heart development; protein amino acid autophosphorylation; motor axon guidance; signal transduction; enzyme linked receptor protein signaling pathway; protein amino acid phosphorylation; positive regulation of transcription from RNA polymerase I promoter; positive regulation of MAP kinase activity; cell surface receptor linked signal transduction; oligodendrocyte differentiation; neuromuscular junction development; epidermal growth factor receptor signaling pathway; negative regulation of immature T cell proliferation in the thymus; regulation of microtubule-based process; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; transcription, DNA-dependent; regulation of angiogenesis; positive regulation of cell growth; peripheral nervous system development; cell proliferation; positive regulation of transcription from RNA polymerase III promoter; innate immune response; positive regulation of protein amino acid phosphorylation; positive regulation of epithelial cell proliferation; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Gastric Cancer; Lung Cancer; Glioma Susceptibility 1

Research Articles on ERBB2

Similar Products

Product Notes

The ERBB2 erbb2 (Catalog #AAA6206063) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ERBB2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Western Blot (WB), In situ Proximity Ligation Assay (Cell). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ERBB2 erbb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ERBB2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.