Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse EPSTI1 Monoclonal Antibody | anti-EPSTI1 antibody

EPSTI1 (Epithelial-stromal Interaction Protein 1, MGC29634) (AP)

Gene Names
EPSTI1; BRESI1
Reactivity
Human, Tetrahymena
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EPSTI1; Monoclonal Antibody; EPSTI1 (Epithelial-stromal Interaction Protein 1; MGC29634) (AP); anti-EPSTI1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Tetrahymena
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A8
Specificity
Recognizes human EPSTI1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EPSTI1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human EPSTI1 (NP_001002264) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNRA
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(EPSTI1 monoclonal antibody, Western Blot analysis of EPSTI1 expression in A-431.)

Western Blot (WB) (EPSTI1 monoclonal antibody, Western Blot analysis of EPSTI1 expression in A-431.)

Western Blot (WB)

(Western Blot analysis of EPSTI1 expression in transfected 293T cell line by EPSTI1 monoclonal antibody. Lane 1: EPSTI1 transfected lysate (36.793kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EPSTI1 expression in transfected 293T cell line by EPSTI1 monoclonal antibody. Lane 1: EPSTI1 transfected lysate (36.793kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EPSTI1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to EPSTI1 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged EPSTI1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EPSTI1 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-EPSTI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
epithelial-stromal interaction protein 1 isoform 1
NCBI Official Synonym Full Names
epithelial stromal interaction 1
NCBI Official Symbol
EPSTI1
NCBI Official Synonym Symbols
BRESI1
NCBI Protein Information
epithelial-stromal interaction protein 1
UniProt Protein Name
Epithelial-stromal interaction protein 1
UniProt Gene Name
EPSTI1
UniProt Entry Name
ESIP1_HUMAN

NCBI Description

The protein encoded by this gene has been shown to promote tumor invasion and metastasis in some invasive cancer cells when overexpressed. Expression of this gene has been shown to be upregulated by direct binding of the Kruppel like factor 8 protein to promoter sequences. The translated protein interacts with the amino terminal region of the valosin containing protein gene product, resulting in the nuclear translocation of the nuclear factor kappa B subunit 1 gene product, and activation of target genes. Overexpression of this gene has been observed in some breast cancers and in some individuals with systemic lupus erythematosus (SLE). [provided by RefSeq, Sep 2016]

Uniprot Description

EPSTI1: 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 13q13.3

Research Articles on EPSTI1

Similar Products

Product Notes

The EPSTI1 epsti1 (Catalog #AAA6131156) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EPSTI1 (Epithelial-stromal Interaction Protein 1, MGC29634) (AP) reacts with Human, Tetrahymena and may cross-react with other species as described in the data sheet. AAA Biotech's EPSTI1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EPSTI1 epsti1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPSTI1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.