Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human, Rat EPS8L2 Monoclonal Antibody | anti-EPS8L2 antibody

EPS8L2 (Epidermal Growth Factor Receptor Kinase Substrate 8-like Protein 2, EPS8-like Protein 2, EPS8-related Protein 2, EPS8R2, FLJ16738, FLJ21935, FLJ22171, MGC3088, MGC126530) (FITC)

Gene Names
EPS8L2; EPS8R2
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EPS8L2; Monoclonal Antibody; EPS8L2 (Epidermal Growth Factor Receptor Kinase Substrate 8-like Protein 2; EPS8-like Protein 2; EPS8-related Protein 2; EPS8R2; FLJ16738; FLJ21935; FLJ22171; MGC3088; MGC126530) (FITC); anti-EPS8L2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6C2
Specificity
Recognizes human EPS8L2. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-EPS8L2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa615-715 from human EPS8L2 (NP_073609) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ERSQPVSQPLTYESGPDEVRAWLEAKAFSPRIVENLGILTGPQLFSLNKEELKKVCGEEGVRVYSQLTMQKAFLEKQQSGSELEELMNKFHSMNQRRGED
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(EPS8L2 monoclonal antibody. Western Blot analysis of EPS8L2 expression in PC-12.)

Western Blot (WB) (EPS8L2 monoclonal antibody. Western Blot analysis of EPS8L2 expression in PC-12.)

Western Blot (WB)

(EPS8L2 monoclonal antibody, Western Blot analysis of EPS8L2 expression in A-431.)

Western Blot (WB) (EPS8L2 monoclonal antibody, Western Blot analysis of EPS8L2 expression in A-431.)

Testing Data

(Detection limit for recombinant GST tagged EPS8L2 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EPS8L2 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-EPS8L2 antibody
Stimulates guanine exchange activity of SOS1. May play a role in membrane ruffling and remodeling of the actin cytoskeleton.
Product Categories/Family for anti-EPS8L2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82,323 Da
NCBI Official Full Name
epidermal growth factor receptor kinase substrate 8-like protein 2
NCBI Official Synonym Full Names
EPS8-like 2
NCBI Official Symbol
EPS8L2
NCBI Official Synonym Symbols
EPS8R2
NCBI Protein Information
epidermal growth factor receptor kinase substrate 8-like protein 2; EPS8-like protein 2; EPS8-related protein 2; epidermal growth factor receptor pathway substrate 8-related protein 2
UniProt Protein Name
Epidermal growth factor receptor kinase substrate 8-like protein 2
UniProt Gene Name
EPS8L2
UniProt Synonym Gene Names
EPS8R2; EPS8-like protein 2
UniProt Entry Name
ES8L2_HUMAN

Uniprot Description

EPS8L2: Stimulates guanine exchange activity of SOS1. May play a role in membrane ruffling and remodeling of the actin cytoskeleton. Belongs to the EPS8 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, Rac/Rho; Actin-binding

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: protein complex; cytoplasm; plasma membrane; vesicle

Molecular Function: Rho guanyl-nucleotide exchange factor activity; Rac guanyl-nucleotide exchange factor activity; actin binding

Biological Process: regulation of Rho protein signal transduction; Rho protein signal transduction

Similar Products

Product Notes

The EPS8L2 eps8l2 (Catalog #AAA6147064) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EPS8L2 (Epidermal Growth Factor Receptor Kinase Substrate 8-like Protein 2, EPS8-like Protein 2, EPS8-related Protein 2, EPS8R2, FLJ16738, FLJ21935, FLJ22171, MGC3088, MGC126530) (FITC) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EPS8L2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EPS8L2 eps8l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPS8L2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.