Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human EPHA6 Monoclonal Antibody | anti-EPHA6 antibody

EPHA6 (Ephrin Type-A Receptor 6, EPH Homology Kinase 2, EHK-2, Ehk-2, Ehk2) (MaxLight 750)

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EPHA6; Monoclonal Antibody; EPHA6 (Ephrin Type-A Receptor 6; EPH Homology Kinase 2; EHK-2; Ehk-2; Ehk2) (MaxLight 750); anti-EPHA6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2H2
Specificity
Recognizes human EPHA6.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-EPHA6 antibody
FLISA, Western Blot (WB)
Application Notes
Sandwich FLISA: The detection limit is ~3ng/ml as a capture antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa613-712 from human EPHA6 (NP_001249) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PSDTGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDGKFHCCSLKTDP
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-EPHA6 antibody

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
UniProt Protein Name
Ephrin type-A receptor 6
Protein Family
UniProt Gene Name
EPHA6
UniProt Synonym Gene Names
EHK2; HEK12; EHK-2; EK12
UniProt Entry Name
EPHA6_HUMAN

Uniprot Description

EphA6: Receptor tyrosine kinase which binds promiscuously GPI- anchored ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Belongs to the protein kinase superfamily. Tyr protein kinase family. Ephrin receptor subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, TK; Protein kinase, tyrosine (receptor); Kinase, protein; EC 2.7.10.1; Membrane protein, integral; TK group; Eph family

Chromosomal Location of Human Ortholog: 3q11.2

Cellular Component: nucleoplasm; integral to plasma membrane; plasma membrane

Molecular Function: ephrin receptor activity; ATP binding

Biological Process: axon guidance; peptidyl-tyrosine phosphorylation; ephrin receptor signaling pathway

Similar Products

Product Notes

The EPHA6 epha6 (Catalog #AAA6232707) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EPHA6 (Ephrin Type-A Receptor 6, EPH Homology Kinase 2, EHK-2, Ehk-2, Ehk2) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EPHA6 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Sandwich FLISA: The detection limit is ~3ng/ml as a capture antibody. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EPHA6 epha6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPHA6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.