Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human EP400 Monoclonal Antibody | anti-EP400 antibody

EP400 (E1A-binding Protein p400, CAG Repeat Protein 32, Domino Homolog, hDomino, Trinucleotide Repeat-containing Gene 12 Protein, p400kD SWI2/SNF2-related Protein, CAGH32, KIAA1498, KIAA1818, TNRC12, DKFZP434I225, FLJ42018, FLJ45115, P400) (Biotin)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EP400; Monoclonal Antibody; EP400 (E1A-binding Protein p400; CAG Repeat Protein 32; Domino Homolog; hDomino; Trinucleotide Repeat-containing Gene 12 Protein; p400kD SWI2/SNF2-related Protein; CAGH32; KIAA1498; KIAA1818; TNRC12; DKFZP434I225; FLJ42018; FLJ45115; P400) (Biotin); anti-EP400 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2A7
Specificity
Recognizes human EP400.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
3122
Applicable Applications for anti-EP400 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa743-851 from human EP400 (NP_056224) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQERRWKVAAAKKLVRTVVRHHEEKQLREERGKKEEQSRLRRIAASTAREIECFWSNIEQV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB)

(Western Blot analysis of EP400 expression in transfected 293T cell line by EP400 monoclonal antibody. Lane 1: EP400 transfected lysate (105.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EP400 expression in transfected 293T cell line by EP400 monoclonal antibody. Lane 1: EP400 transfected lysate (105.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-EP400 antibody
Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. May be required for transcriptional activation of E2F1 and MYC target genes during cellular proliferation. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. May regulate ZNF42 transcription activity.
Product Categories/Family for anti-EP400 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
E1A-binding protein p400
Protein Family

Similar Products

Product Notes

The EP400 (Catalog #AAA6141741) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EP400 (E1A-binding Protein p400, CAG Repeat Protein 32, Domino Homolog, hDomino, Trinucleotide Repeat-containing Gene 12 Protein, p400kD SWI2/SNF2-related Protein, CAGH32, KIAA1498, KIAA1818, TNRC12, DKFZP434I225, FLJ42018, FLJ45115, P400) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EP400 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EP400 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EP400, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.