Mouse anti-Human ENTPD5 Monoclonal Antibody | anti-ENTPD5 antibody

ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5, NTPDase 5, CD39 Antigen-like 4, ER-UDPase, Guanosine-diphosphatase ENTPD5, GDPase ENTPD5, Nucleoside Diphosphatase, Uridine-diphosphatase ENTPD5, UDPase ENTPD5, CD39L4, PCPH) (HRP)

Cat. Num. AAA6152346

• Gene Names: ENTPD5; PCPH; CD39L4; NTPDase-5
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ENTPD5; Monoclonal Antibody; ENTPD5 (Ectonucleoside Triphosphate Diphosphohydrolase 5; NTPDase 5; CD39 Antigen-like 4; ER-UDPase; Guanosine-diphosphatase ENTPD5; GDPase ENTPD5; Nucleoside Diphosphatase; Uridine-diphosphatase ENTPD5; UDPase ENTPD5; CD39L4; PCPH) (HRP); anti-ENTPD5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4A5
• Specificity: Recognizes human ENTPD5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-ENTPD5 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa319-400 from human ENTPD5 (NP_001240) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: EEVQRGSFYAFSYYYDRAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQ
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ENTPD5 monoclonal antibody, Western Blot analysis of ENTPD5 expression in HepG2.)

Testing Data

(Detection limit for recombinant GST tagged ENTPD5 is ~0.3ng/ml as a capture antibody)

Related Product Information for anti-ENTPD5 antibody

CD39L4, also called ENTPD5 (ectonucleoside triphosphate diphosphohydrolase 5), ERUDPase and PCPH, is a secreted, 45-51kD class II member of the GDA1/CD39 NTPase family of molecules. It is expressed by multiple cell types, including neurons, cardiomyocytes, and hepatocytes. CD39L4 is a divalent cation dependent enzyme that preferentially hydrolyzes GDP and UDP. In the ER, this enzyme may remove UDP which interferes with proper protein folding and maturation. Extracellularly, CD39L4 may reduce available UDP ligand for P2Y receptors. Mature human CD39L4 is a 408aa glycoprotein (aa21-428). It contains four APR (apyrase conserved regions) (aa54-206) that participate in NTPase activity. CD39L4 has been reported to exist as both monomer and homodimer. Three potential splice variants are reported. One shows a seven aa substitution for aa401-428, a second contains a five aa substitution for aa401-428, and a third possesses a 22aa substitution for aa215-428. Over aa21-428, human CD39L4 shares 89% aa sequence identity with mouse CD39L4.

Product Categories/Family for anti-ENTPD5 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 4557427
• NCBI GeneID: 957
• NCBI Accession #: NP_001240
• NCBI GenBank Nucleotide #: NM_001249
• UniProt Accession #: O75356; Q96RX0; A1L4C5
• Molecular Weight: 47,517 Da
• NCBI Official Full Name: ectonucleoside triphosphate diphosphohydrolase 5
• NCBI Official Synonym Full Names: ectonucleoside triphosphate diphosphohydrolase 5
• NCBI Official Symbol: ENTPD5
• NCBI Official Synonym Symbols: PCPH; CD39L4; NTPDase-5
• NCBI Protein Information: ectonucleoside triphosphate diphosphohydrolase 5; CD39 antigen-like 4; CD39-like 4; ER-UDPase; GDPase ENTPD5; NTPDase 5; Pcph proto-oncogene protein; UDPase ENTPD5; guanosine-diphosphatase ENTPD5; nucleoside diphosphatase; proto-oncogene CPH; uridine-diph
• UniProt Protein Name: Ectonucleoside triphosphate diphosphohydrolase 5
• Protein Family: Ectonucleoside triphosphate diphosphohydrolase
• UniProt Gene Name: ENTPD5
• UniProt Synonym Gene Names: CD39L4; PCPH; NTPDase 5; GDPase ENTPD5; UDPase ENTPD5
• UniProt Entry Name: ENTP5_HUMAN

Uniprot Description

ENTPD5: Uridine diphosphatase (UDPase) that promotes protein N- glycosylation and ATP level regulation. UDP hydrolysis promotes protein N-glycosylation and folding in the endoplasmic reticulum, as well as elevated ATP consumption in the cytosol via an ATP hydrolysis cycle. Together with CMPK1 and AK1, constitutes an ATP hydrolysis cycle that converts ATP to AMP and results in a compensatory increase in aerobic glycolysis. Also hydrolyzes GDP and IDP but not any other nucleoside di-, mono- or triphosphates, nor thiamine pyrophosphate. Plays a key role in the AKT1-PTEN signaling pathway by promoting glycolysis in proliferating cells in response to phosphoinositide 3-kinase (PI3K) signaling. Belongs to the GDA1/CD39 NTPase family.

Protein type: Nucleotide Metabolism - purine; EC 3.6.1.6; EC 3.6.1.42; Oncoprotein; Nucleotide Metabolism - pyrimidine; Hydrolase

Chromosomal Location of Human Ortholog: 14q24

Cellular Component: endoplasmic reticulum

Molecular Function: guanosine-diphosphatase activity; uridine-diphosphatase activity

Biological Process: ATP metabolic process; cell proliferation; 'de novo' posttranslational protein folding; positive regulation of glycolysis; regulation of phosphoinositide 3-kinase cascade; protein amino acid N-linked glycosylation; cell growth