Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (45.32kD).)

Mouse anti-Human Endothelin 2 Monoclonal Antibody | anti-EDN2 antibody

Endothelin 2 (Endothelin-2, EDN2, ET2, ET-2, Preproendothelin-2, PPET2) (HRP)

Gene Names
EDN2; ET2; ET-2; PPET2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Endothelin 2; Monoclonal Antibody; Endothelin 2 (Endothelin-2; EDN2; ET2; ET-2; Preproendothelin-2; PPET2) (HRP); anti-EDN2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3B4-1C5
Specificity
Recognizes human EDN2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-EDN2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-178 from human EDN2 (AAH34393) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVSVPTTWCSVALALLVALHEGKGQAAATLEQPASSSHAQGTHLRLRRCSCSSWLDKECVYFCHLDIIWVNTPEQTAPYGLGNPPRRRRRSLPRRCQCSSARDPACATFCLRRPWTEAGAVPSRKSPADVFQTGKTGATTGELLQRLRDISTVKSLFAKRQQEAMREPRSTHSRWRKR
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (45.32kD).)

Western Blot (WB) (Western Blot detection against Immunogen (45.32kD).)

Western Blot (WB)

(Western Blot analysis of EDN2 expression in transfected 293T cell line by EDN2 monoclonal antibody. Lane 1: EDN2 transfected lysate (20kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EDN2 expression in transfected 293T cell line by EDN2 monoclonal antibody. Lane 1: EDN2 transfected lysate (20kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-EDN2 antibody
Endothelins (ET) show potent constrictor activity in vascular and non-vascular smooth muscle. This family of 21-amino acid peptides exists in at least three isoforms, ET-1, ET-2, and ET-3, and is produced in endothelial and epithelial cells. ET's can mediate biological effects in cells and tissues, and have been shown to bind to an ET receptor in the lung, kidney, heart and liver.
Product Categories/Family for anti-EDN2 antibody
References
1. Estrogen and progesterone regulate expression of the endothelins in the rhesus macaque endometrium. Keator CS, Mah K, Ohm L, Slayden OD.Hum Reprod. 2011 Apr 19.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
19,960 Da
NCBI Official Full Name
Homo sapiens endothelin 2, mRNA
NCBI Official Synonym Full Names
endothelin 2
NCBI Official Symbol
EDN2
NCBI Official Synonym Symbols
ET2; ET-2; PPET2
NCBI Protein Information
endothelin-2
Protein Family

NCBI Description

This gene encodes a member of the endothelin protein family of secretory vasoconstrictive peptides. The preproprotein is processed to a short mature form which functions as a ligand for the endothelin receptors that initiate intracellular signaling events. This gene product is involved in a wide range of biological processes, such as hypertension and ovulation. Altered expression of this gene is implicated in tumorigenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2014]

Research Articles on EDN2

Similar Products

Product Notes

The EDN2 (Catalog #AAA6152338) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Endothelin 2 (Endothelin-2, EDN2, ET2, ET-2, Preproendothelin-2, PPET2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Endothelin 2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EDN2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Endothelin 2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.