Mouse ENDOGL1 Monoclonal Antibody | anti-ENDOGL1 antibody
ENDOGL1 (Nuclease EXOG, Mitochondrial, Endonuclease G-like 1, Endo G-like 1, EXOG, ENGL, ENDOGL2) (MaxLight 750)
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot, Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ENDOGL1; Monoclonal Antibody; ENDOGL1 (Nuclease EXOG; Mitochondrial; Endonuclease G-like 1; Endo G-like 1; EXOG; ENGL; ENDOGL2) (MaxLight 750); anti-ENDOGL1 antibody
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F7
Specificity
Recognizes human ENDOGL1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Sequence Length
368
Applicable Applications for anti-ENDOGL1 antibody
FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB), Immunofluorescence (IF)
Application Notes
IHC-P: 3ug/ml
IF: 10ug/ml
Applications are based on unconjugated antibody.
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa269-368, from ENDOGL1 (NP_005098) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-ENDOGL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
nuclease EXOG, mitochondrial isoform 1
UniProt Protein Name
Nuclease EXOG, mitochondrial
UniProt Gene Name
EXOG
UniProt Synonym Gene Names
ENDOGL1; ENDOGL2; ENGL; Endo G-like 1
UniProt Entry Name
EXOG_HUMAN
Uniprot Description
ENDOGL1: Endo/exonuclease with nicking activity towards supercoiled DNA, a preference for single stranded DNA and 5'-3' exonuclease activity. Belongs to the DNA/RNA non-specific endonuclease family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Mitochondrial; Deoxyribonuclease; EC 3.1.30.-; Ribonuclease
Chromosomal Location of Human Ortholog: 3p21.3
Cellular Component: mitochondrion; mitochondrial inner membrane
Molecular Function: nucleic acid binding; endonuclease activity; metal ion binding
Biological Process: DNA catabolic process, endonucleolytic
Similar Products
Product Notes
The ENDOGL1 exog (Catalog #AAA6232686) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ENDOGL1 (Nuclease EXOG, Mitochondrial, Endonuclease G-like 1, Endo G-like 1, EXOG, ENGL, ENDOGL2) (MaxLight 750) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ENDOGL1 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunohistochemistry (IHC) Paraffin, Western Blot (WB), Immunofluorescence (IF). IHC-P: 3ug/ml IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ENDOGL1 exog for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ENDOGL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
