Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (ENDOGL1 monoclonal antibody Western Blot analysis of ENDOGL1 expression in HepG2.)

Mouse ENDOGL1 Monoclonal Antibody | anti-ENDOGL1 antibody

ENDOGL1 (Nuclease EXOG, Mitochondrial, Endonuclease G-like 1, Endo G-like 1, EXOG, ENGL, ENDOGL2) APC

Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot, Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ENDOGL1; Monoclonal Antibody; ENDOGL1 (Nuclease EXOG; Mitochondrial; Endonuclease G-like 1; Endo G-like 1; EXOG; ENGL; ENDOGL2) APC; anti-ENDOGL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F7
Specificity
Recognizes human ENDOGL1. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
368
Applicable Applications for anti-ENDOGL1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB), Immunofluorescence (IF)
Application Notes
IHC-P: 3ug/ml
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa269-368, from ENDOGL1 (NP_005098) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LQDLEKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGARSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(ENDOGL1 monoclonal antibody Western Blot analysis of ENDOGL1 expression in HepG2.)

Western Blot (WB) (ENDOGL1 monoclonal antibody Western Blot analysis of ENDOGL1 expression in HepG2.)

Western Blot (WB)

(ENDOGL1 monoclonal antibody Western Blot analysis of ENDOGL1 expression in Raw 264.7.)

Western Blot (WB) (ENDOGL1 monoclonal antibody Western Blot analysis of ENDOGL1 expression in Raw 264.7.)

Western Blot (WB)

(ENDOGL1 monoclonal antibody Western Blot analysis of ENDOGL1 expression in NIH/3T3.)

Western Blot (WB) (ENDOGL1 monoclonal antibody Western Blot analysis of ENDOGL1 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EXOG on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to EXOG on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to EXOG on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to EXOG on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-ENDOGL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
nuclease EXOG, mitochondrial isoform 1
UniProt Protein Name
Nuclease EXOG, mitochondrial
UniProt Gene Name
EXOG
UniProt Synonym Gene Names
ENDOGL1; ENDOGL2; ENGL; Endo G-like 1
UniProt Entry Name
EXOG_HUMAN

Uniprot Description

ENDOGL1: Endo/exonuclease with nicking activity towards supercoiled DNA, a preference for single stranded DNA and 5'-3' exonuclease activity. Belongs to the DNA/RNA non-specific endonuclease family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; Deoxyribonuclease; EC 3.1.30.-; Ribonuclease

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: mitochondrion; mitochondrial inner membrane

Molecular Function: nucleic acid binding; endonuclease activity; metal ion binding

Biological Process: DNA catabolic process, endonucleolytic

Similar Products

Product Notes

The ENDOGL1 exog (Catalog #AAA6136426) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ENDOGL1 (Nuclease EXOG, Mitochondrial, Endonuclease G-like 1, Endo G-like 1, EXOG, ENGL, ENDOGL2) APC reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ENDOGL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB), Immunofluorescence (IF). IHC-P: 3ug/ml IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ENDOGL1 exog for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ENDOGL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.