Mouse EMX2 Monoclonal Antibody | anti-EMX2 antibody

EMX2 (Empty Spiracles Homeobox 2) (HRP)

Cat. Num. AAA6179211

• Applications: ELISA, Immunofluorescence
• Purity: Purified
• Synonyms: EMX2; Monoclonal Antibody; EMX2 (Empty Spiracles Homeobox 2) (HRP); Empty Spiracles Homeobox 2; anti-EMX2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4D8
• Specificity: Recognizes EMX2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-EMX2 antibody: ELISA (EIA), Immunofluorescence (IF)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: EMX2 (NP_004089, 103aa-200aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: HSPHPLFASQQRDPSTFYPWLIHRYRYLGHRFQGNDTSPESFLLHNALARKPKRIRTAFSPSQLLRLEHAFEKNHYVVGAERKQLAHSLSLTETQVKV
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to EMX2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to EMX2 on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-EMX2 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 14149611
• NCBI GeneID: 2018
• NCBI Accession #: NP_004089
• NCBI GenBank Nucleotide #: NM_004098
• UniProt Accession #: Q04743
• Molecular Weight: 28kDa
• NCBI Official Full Name: homeobox protein EMX2 isoform 1
• NCBI Official Synonym Full Names: empty spiracles homeobox 2
• NCBI Official Symbol: EMX2
• NCBI Protein Information: homeobox protein EMX2
• UniProt Protein Name: Homeobox protein EMX2
• Protein Family: Homeobox protein
• UniProt Gene Name: EMX2
• UniProt Entry Name: EMX2_HUMAN

NCBI Description

This gene encodes a homeobox-containing transcription factor that is the homolog to the 'empty spiracles' gene in Drosophila. Research on this gene in humans has focused on its expression in three tissues: dorsal telencephalon, olfactory neuroepithelium, and urogenetial system. It is expressed in the dorsal telencephalon during development in a low rostral-lateral to high caudal-medial gradient and is proposed to pattern the neocortex into defined functional areas. It is also expressed in embryonic and adult olfactory neuroepithelia where it complexes with eukaryotic translation initiation factor 4E (eIF4E) and possibly regulates mRNA transport or translation. In the developing urogenital system, it is expressed in epithelial tissues and is negatively regulated by HOXA10. Alternative splicing results in multiple transcript variants encoding distinct proteins.[provided by RefSeq, Sep 2009]

Uniprot Description

EMX2: Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system. Defects in EMX2 are the cause of schizencephaly (SCHZC). Schizencephaly is an extremely rare human congenital disorder characterized by a full-thickness cleft within the cerebral hemispheres. These clefts are lined with gray matter and most commonly involve the parasylvian regions. Large portions of the cerebral hemispheres may be absent and replaced by cerebro- spinal fluid. Belongs to the EMX homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 10q26.1

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding

Biological Process: response to drug; forebrain cell migration; anterior/posterior pattern formation; neuron differentiation; dentate gyrus development; regulation of transcription, DNA-dependent; cell proliferation in forebrain; cerebral cortex regionalization

Disease: Schizencephaly