Western Blot (WB)
(Western Blot detection against Immunogen (36.63kD).)
Mouse anti-Human EMAL1 Monoclonal Antibody
EMAL1 (Echinoderm Microtubule-associated Protein-like 1, EMAP-1, HuEMAP-1, EMAPL1, EMAPL, EMAP1, EML1)
Reactivity
Human
Applications
ELISA, Western Blot
Purity
AscitesAscites
Synonyms
EMAL1; Monoclonal Antibody; EMAL1 (Echinoderm Microtubule-associated Protein-like 1; EMAP-1; HuEMAP-1; EMAPL1; EMAPL; EMAP1; EML1); Anti -EMAL1 (Echinoderm Microtubule-associated Protein-like 1; anti-EMAL1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgM,k
Clone Number
5G3
Specificity
Recognizes human EML1.
Purity/Purification
Ascites
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
MEDGFSSYSSLYDTSSLLQFCNDDSASAASSMEVTDRIASLEQRVQMQEDDIQLLKSALADVVRRLNITEEQQAVLNRKGPTKARPLMQTLPLRTTVNN
Applicable Applications for anti-EMAL1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1-99 from human EML1 (NP_001008707) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (36.63kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (36.63kD).)
Western Blot (WB)
(EML1 monoclonal antibody, Western Blot analysis of EML1 expression in HepG2.)
Western Blot (WB)
(EML1 monoclonal antibody, Western Blot analysis of EML1 expression in HepG2.)
Related Product Information for anti-EMAL1 antibody
Human echinoderm microtubule-associated protein-like is a strong candidate for the Usher syndrome type 1A gene. Usher syndromes (USHs) are a group of genetic disorders consisting of congenital deafness, retinitis pigmentosa, and vestibular dysfunction of variable onset and severity depending on the genetic type. The disease process in USHs involves the entire brain and is not limited to the posterior fossa or auditory and visual systems. The USHs are catagorized as type I (USH1A, USH1B, USH1C, USH1D, USH1E and USH1F), type II (USH2A and USH2B) and type III (USH3). The type I is the most severe form.
Product Categories/Family for anti-EMAL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
Echinoderm microtubule-associated protein-like 1
Similar Products
Product Notes
The EMAL1 (Catalog #AAA6003438) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EMAL1 (Echinoderm Microtubule-associated Protein-like 1, EMAP-1, HuEMAP-1, EMAPL1, EMAPL, EMAP1, EML1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EMAL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the EMAL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MEDGFSSYSS LYDTSSLLQF CNDDSASAAS SMEVTDRIAS LEQRVQMQED DIQLLKSALA DVVRRLNITE EQQAVLNRKG PTKARPLMQT LPLRTTVNN. It is sometimes possible for the material contained within the vial of "EMAL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
