Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ELMO2 is 0.1 ng/ml as a capture antibody.)

Mouse ELMO2 Monoclonal Antibody | anti-ELMO2 antibody

ELMO2 (Engulfment and Cell Motility 2, CED-12, CED12, ELMO-2, FLJ11656, KIAA1834) (AP)

Gene Names
ELMO2; CED12; CED-12; ELMO-2
Applications
ELISA
Purity
Purified
Synonyms
ELMO2; Monoclonal Antibody; ELMO2 (Engulfment and Cell Motility 2; CED-12; CED12; ELMO-2; FLJ11656; KIAA1834) (AP); Engulfment and Cell Motility 2; KIAA1834; anti-ELMO2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3G7
Specificity
Recognizes ELMO2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-ELMO2 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
ELMO2 (NP_573403.1, 89aa-188aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MERTQSSNMETRLDAMKELAKLSADVTFATEFINMDGIIVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYVSQPMVDVS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ELMO2 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ELMO2 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-ELMO2 antibody
The protein encoded by this gene interacts with the dedicator of cyto-kinesis 1 protein. Similarity to a C. elegans protein suggests that this protein may function in phagocytosis of apoptotic cells and in cell migration. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq]
Product Categories/Family for anti-ELMO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82,615 Da
NCBI Official Full Name
engulfment and cell motility protein 2
NCBI Official Synonym Full Names
engulfment and cell motility 2
NCBI Official Symbol
ELMO2
NCBI Official Synonym Symbols
CED12; CED-12; ELMO-2
NCBI Protein Information
engulfment and cell motility protein 2; hCed-12A; ced-12 homolog 2; PH domain protein CED12A; protein ced-12 homolog A
UniProt Protein Name
Engulfment and cell motility protein 2
UniProt Gene Name
ELMO2
UniProt Synonym Gene Names
CED12A; KIAA1834; hCed-12A
UniProt Entry Name
ELMO2_HUMAN

NCBI Description

The protein encoded by this gene interacts with the dedicator of cyto-kinesis 1 protein. Similarity to a C. elegans protein suggests that this protein may function in phagocytosis of apoptotic cells and in cell migration. Alternative splicing results in multiple transcript variants encoding the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

ELMO2: Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in assocation with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1.

Protein type: Cytoskeletal; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 20q13

Cellular Component: cytoskeleton; membrane; cytoplasm; cytosol

Molecular Function: protein binding; receptor tyrosine kinase binding; SH3 domain binding

Biological Process: apoptosis; innate immune response; vascular endothelial growth factor receptor signaling pathway

Research Articles on ELMO2

Similar Products

Product Notes

The ELMO2 elmo2 (Catalog #AAA6164312) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's ELMO2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ELMO2 elmo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ELMO2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.