Mouse ELA2 Monoclonal Antibody | anti-ELA2 antibody

ELA2 (Elastase 2, Neutrophil, GE, HLE, HNE, NE, PMN-E) (AP)

Cat. Num. AAA6162112

• Gene Names: ELANE; GE; NE; HLE; HNE; ELA2; SCN1; PMN-E
• Applications: ELISA
• Purity: Purified
• Synonyms: ELA2; Monoclonal Antibody; ELA2 (Elastase 2; Neutrophil; GE; HLE; HNE; NE; PMN-E) (AP); Elastase 2; PMN-E; anti-ELA2 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B11
• Specificity: Recognizes ELA2.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-ELA2 antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ELA2 (NP_001963, 168aa-267aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: VLQELNVTVVTSLCRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVNWIDSIIQRSEDNPCPHPRDPDPASRTH
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ELA2 is approximately 1ng/ml as a capture antibody.)

Related Product Information for anti-ELA2 antibody

Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins. The product of this gene hydrolyzes proteins within specialized neutrophil lysosomes, called azurophil granules, as well as proteins of the extracellular matrix following the protein's release from activated neutrophils. The enzyme may play a role in degenerative and inflammatory diseases by its proteolysis of collagen-IV and elastin of the extracellular matrix. This protein degrades the outer membrane protein A (OmpA) of E. coli as well as the virulence factors of such bacteria as Shigella, Salmonella and Yersinia. Mutations in this gene are associated with cyclic neutropenia and severe congenital neutropenia (SCN). This gene is clustered with other serine protease gene family members, azurocidin 1 and proteinase 3 genes, at chromosome 19pter. All 3 genes are expressed coordinately and their protein products are packaged together into azurophil granules during neutrophil differentiation. [provided by RefSeq]

Product Categories/Family for anti-ELA2 antibody

Antibodies; Elastase

NCBI and Uniprot Product Information

• NCBI GI #: 4503549
• NCBI GeneID: 1991
• NCBI Accession #: NP_001963
• NCBI GenBank Nucleotide #: NM_001972
• UniProt Accession #: P08246; P09649; Q6B0D9; Q6LDP5
• Molecular Weight: 28,518 Da
• NCBI Official Full Name: neutrophil elastase preproprotein
• NCBI Official Synonym Full Names: elastase, neutrophil expressed
• NCBI Official Symbol: ELANE
• NCBI Official Synonym Symbols: GE; NE; HLE; HNE; ELA2; SCN1; PMN-E
• NCBI Protein Information: neutrophil elastase; PMN elastase; bone marrow serine protease; elastase 2, neutrophil; elastase-2; granulocyte-derived elastase; human leukocyte elastase; medullasin; polymorphonuclear elastase
• UniProt Protein Name: Neutrophil elastase
• UniProt Gene Name: ELANE
• UniProt Synonym Gene Names: ELA2; HLE
• UniProt Entry Name: ELNE_HUMAN

Uniprot Description

ELANE: Modifies the functions of natural killer cells, monocytes and granulocytes. Inhibits C5a-dependent neutrophil enzyme release and chemotaxis. Defects in ELANE are a cause of cyclic haematopoiesis (CH); also known as cyclic neutropenia. CH is an autosomal dominant disease in which blood-cell production from the bone marrow oscillates with 21-day periodicity. Circulating neutrophils vary between almost normal numbers and zero. During intervals of neutropenia, affected individuals are at risk for opportunistic infection. Monocytes, platelets, lymphocytes and reticulocytes also cycle with the same frequency. Defects in ELANE are the cause of neutropenia severe congenital autosomal dominant type 1 (SCN1). SCN1 is a disorder of hematopoiesis characterized by a maturation arrest of granulopoiesis at the level of promyelocytes with peripheral blood absolute neutrophil counts below 0.5 x 10(9)/l and early onset of severe bacterial infections. Belongs to the peptidase S1 family. Elastase subfamily.

Protein type: Cell surface; Motility/polarity/chemotaxis; EC 3.4.21.37; Cell cycle regulation; Protease

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: cell surface; transcriptional repressor complex; cytoplasm; extracellular region; secretory granule

Molecular Function: peptidase activity; heparin binding; protein binding; protease binding; cytokine binding; serine-type endopeptidase activity; endopeptidase activity

Biological Process: positive regulation of immune response; extracellular matrix organization and biogenesis; positive regulation of smooth muscle cell proliferation; negative regulation of interleukin-8 biosynthetic process; positive regulation of interleukin-8 biosynthetic process; response to lipopolysaccharide; negative regulation of transcription from RNA polymerase II promoter; negative regulation of chemotaxis; proteolysis; phagocytosis; cellular calcium ion homeostasis; positive regulation of MAP kinase activity; extracellular matrix disassembly; collagen catabolic process; negative regulation of inflammatory response; defense response to bacterium; protein catabolic process; response to yeast; leukocyte migration; response to UV; negative regulation of chemokine biosynthetic process; acute inflammatory response to antigenic stimulus

Disease: Cyclic Neutropenia; Neutropenia, Severe Congenital, 1, Autosomal Dominant