Mouse anti-Human EIF4EBP3 Monoclonal Antibody | anti-EIF4EBP3 antibody

EIF4EBP3 (Eukaryotic Translation Initiation Factor 4E-binding Protein 3, 4E-BP3, eIF4E-Binding Protein 3) (FITC)

Cat. Num. AAA6147000

• Gene Names: EIF4EBP3; 4EBP3; 4E-BP3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EIF4EBP3; Monoclonal Antibody; EIF4EBP3 (Eukaryotic Translation Initiation Factor 4E-binding Protein 3; 4E-BP3; eIF4E-Binding Protein 3) (FITC); anti-EIF4EBP3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4C1
• Specificity: Recognizes human EIF4EBP3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-EIF4EBP3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-101 from EIF4EBP3 (NP_003723) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTPPTAPLSKLEELKEQETEEEIPDDAQFEMDI*
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of EIF4EBP3 expression in transfected 293T cell line by EIF4EBP3 monoclonal antibody Lane 1: EIF4EBP3 transfected lysate (10.873kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-EIF4EBP3 antibody

Regulates eIF4E activity by preventing its assembly into the eIF4F complex.

Product Categories/Family for anti-EIF4EBP3 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4503537
• NCBI GeneID: 8637
• NCBI Accession #: NP_003723
• NCBI GenBank Nucleotide #: NM_003732
• UniProt Accession #: O60516
• Molecular Weight: 13.3 kDa (123aa) confirmed by MALDI-TOF
• NCBI Official Full Name: eukaryotic translation initiation factor 4E-binding protein 3
• NCBI Official Synonym Full Names: eukaryotic translation initiation factor 4E binding protein 3
• NCBI Official Symbol: EIF4EBP3
• NCBI Official Synonym Symbols: 4EBP3; 4E-BP3
• NCBI Protein Information: eukaryotic translation initiation factor 4E-binding protein 3
• UniProt Protein Name: Eukaryotic translation initiation factor 4E-binding protein 3
• Protein Family: Eukaryotic translation initiation factor 4E-binding protein
• UniProt Gene Name: EIF4EBP3
• UniProt Synonym Gene Names: 4E-BP3; eIF4E-binding protein 3
• UniProt Entry Name: 4EBP3_HUMAN

NCBI Description

This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap structure. Read-through transcription from the neighboring upstream gene (MASK or ANKHD1) generates a transcript (MASK-BP3) that encodes a protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq, Oct 2010]

Uniprot Description

4E-BP3: Regulates eIF4E activity by preventing its assembly into the eIF4F complex. EIF4EBP3 interacts with EIF4E. Expression is highest in skeletal muscle, heart, kidney, and pancreas, whereas there is very little expression in brain and thymus. Belongs to the eIF4E-binding protein family.

Protein type: Translation; Translation initiation

Chromosomal Location of Human Ortholog: 5q31.3

Cellular Component: cytoplasm; membrane

Molecular Function: eukaryotic initiation factor 4E binding; protein binding

Biological Process: negative regulation of translational initiation