<
Western Blot (WB)
(Western Blot detection against Immunogen (52.69kD).)
Mouse anti-Human EIF4E2 Monoclonal Antibody | anti-EIF4E2 antibody
EIF4E2 (EIF4EL3, Eukaryotic Translation Initiation Factor 4E Type 2, Eukaryotic Translation Initiation Factor 4E Homologous Protein, Eukaryotic Translation Initiation Factor 4E-like 3, eIF4E-like Protein 4E-LP, mRNA Cap-binding Protein 4EHP, mRNA Cap-bind
Gene Names
EIF4E2; 4EHP; IF4e; 4E-LP; EIF4EL3
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EIF4E2; Monoclonal Antibody; EIF4E2 (EIF4EL3; Eukaryotic Translation Initiation Factor 4E Type 2; Eukaryotic Translation Initiation Factor 4E Homologous Protein; Eukaryotic Translation Initiation Factor 4E-like 3; eIF4E-like Protein 4E-LP; mRNA Cap-binding Protein 4EHP; mRNA Cap-bind; anti-EIF4E2 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4G10
Specificity
Recognizes human EIF4E2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-EIF4E2 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-245 from EIF4E2 (AAH05392) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (52.69kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (52.69kD).)
Western Blot (WB)
(EIF4E2 monoclonal antibody Western Blot analysis of EIF4E2 expression in HeLa)
Western Blot (WB)
(EIF4E2 monoclonal antibody Western Blot analysis of EIF4E2 expression in HeLa)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to EIF4E2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to EIF4E2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EIF4E2 on HeLa cell. [antibody concentration 10ug/ml)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to EIF4E2 on HeLa cell. [antibody concentration 10ug/ml)
Product Categories/Family for anti-EIF4E2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
27,026 Da
NCBI Official Full Name
Homo sapiens eukaryotic translation initiation factor 4E family member 2, mRNA
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 4E family member 2
NCBI Official Symbol
EIF4E2
NCBI Official Synonym Symbols
4EHP; IF4e; 4E-LP; EIF4EL3
NCBI Protein Information
eukaryotic translation initiation factor 4E type 2
Protein Family
Research Articles on EIF4E2
Similar Products
Product Notes
The EIF4E2 (Catalog #AAA6141694) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EIF4E2 (EIF4EL3, Eukaryotic Translation Initiation Factor 4E Type 2, Eukaryotic Translation Initiation Factor 4E Homologous Protein, Eukaryotic Translation Initiation Factor 4E-like 3, eIF4E-like Protein 4E-LP, mRNA Cap-binding Protein 4EHP, mRNA Cap-bind reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EIF4E2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EIF4E2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EIF4E2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
