Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged EIF2AK3 is 0.03 ng/ml as a capture antibody.)

Mouse EIF2AK3 Monoclonal Antibody | anti-EIF2AK3 antibody

EIF2AK3 (Eukaryotic Translation Initiation Factor 2-alpha Kinase 3, DKFZp781H1925, HRI, PEK, PERK, WRS) (AP)

Gene Names
MAP3K10; MST; MLK2; MEKK10
Applications
Western Blot
Purity
Purified
Synonyms
EIF2AK3; Monoclonal Antibody; EIF2AK3 (Eukaryotic Translation Initiation Factor 2-alpha Kinase 3; DKFZp781H1925; HRI; PEK; PERK; WRS) (AP); Eukaryotic Translation Initiation Factor 2-alpha Kinase 3; WRS; anti-EIF2AK3 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7B10
Specificity
Recognizes EIF2AK3.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-EIF2AK3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
EIF2AK3 (NP_002437, 665aa-764aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFSTKEHIEIIAPSPQRSRSFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDS
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged EIF2AK3 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EIF2AK3 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-EIF2AK3 antibody
Mouse monoclonal antibody raised against a partial recombinant EIF2AK3.
Product Categories/Family for anti-EIF2AK3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
104kDa
NCBI Official Full Name
mitogen-activated protein kinase kinase kinase 10
NCBI Official Synonym Full Names
mitogen-activated protein kinase kinase kinase 10
NCBI Official Symbol
MAP3K10
NCBI Official Synonym Symbols
MST; MLK2; MEKK10
NCBI Protein Information
mitogen-activated protein kinase kinase kinase 10
UniProt Protein Name
Mitogen-activated protein kinase kinase kinase 10
UniProt Gene Name
MAP3K10
UniProt Synonym Gene Names
MLK2; MST
UniProt Entry Name
M3K10_HUMAN

NCBI Description

The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase has been shown to activate MAPK8/JNK and MKK4/SEK1, and this kinase itself can be phoshorylated, and thus activated by JNK kinases. This kinase functions preferentially on the JNK signaling pathway, and is reported to be involved in nerve growth factor (NGF) induced neuronal apoptosis. [provided by RefSeq, Jul 2008]

Uniprot Description

MLK2: a TKL kinase of the MLK family. A dual leucine zipper kinase. Phosphorylates and activates JNK and SEK1. Interacts with PAK and NCK. May be involved in nerve growth factor-induced neuronal apoptosis.

Protein type: Kinase, protein; EC 2.7.11.25; Protein kinase, TKL; Protein kinase, Ser/Thr (non-receptor); TKL group; MLK family; MLK subfamily

Chromosomal Location of Human Ortholog: 19q13.2

Cellular Component: cytoplasm

Molecular Function: protein serine/threonine kinase activity; JUN kinase kinase kinase activity; protein homodimerization activity; bHLH transcription factor binding; transcription corepressor activity; ATP binding; protein kinase activity

Biological Process: positive regulation of JNK activity; smoothened signaling pathway; positive regulation of apoptosis; apoptosis; protein amino acid autophosphorylation; negative regulation of transcription factor activity; peptidyl-threonine phosphorylation; positive regulation of JNK cascade; signal transduction; activation of JNK activity; peptidyl-serine phosphorylation; JNK cascade; negative regulation of transcription, DNA-dependent; activation of JNKK activity

Research Articles on EIF2AK3

Similar Products

Product Notes

The EIF2AK3 map3k10 (Catalog #AAA6165831) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's EIF2AK3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EIF2AK3 map3k10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EIF2AK3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.