Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human EIF2AK2 Monoclonal Antibody | anti-EIF2AK2 antibody

EIF2AK2 (PKR, PRKR, Interferon-induced, Double-stranded RNA-activated Protein Kinase, Eukaryotic Translation Initiation Factor 2-alpha Kinase 2, Interferon-inducible RNA-dependent Protein Kinase, P1/eIF-2A Protein Kinase, Protein Kinase RNA-activated, Tyr

Gene Names
EIF2AK2; PKR; PRKR; EIF2AK1; PPP1R83
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EIF2AK2; Monoclonal Antibody; EIF2AK2 (PKR; PRKR; Interferon-induced; Double-stranded RNA-activated Protein Kinase; Eukaryotic Translation Initiation Factor 2-alpha Kinase 2; Interferon-inducible RNA-dependent Protein Kinase; P1/eIF-2A Protein Kinase; Protein Kinase RNA-activated; Tyr; anti-EIF2AK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B9
Specificity
Recognizes human EIF2AK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-EIF2AK2 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101, from human EIF2AK2 (NP_002750) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGN*
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-EIF2AK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
interferon-induced, double-stranded RNA-activated protein kinase isoform a
NCBI Official Synonym Full Names
eukaryotic translation initiation factor 2 alpha kinase 2
NCBI Official Symbol
EIF2AK2
NCBI Official Synonym Symbols
PKR; PRKR; EIF2AK1; PPP1R83
NCBI Protein Information
interferon-induced, double-stranded RNA-activated protein kinase
UniProt Protein Name
Interferon-induced, double-stranded RNA-activated protein kinase
UniProt Gene Name
EIF2AK2
UniProt Synonym Gene Names
PKR; PRKR; eIF-2A protein kinase 2; PKR
UniProt Entry Name
E2AK2_HUMAN

NCBI Description

The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits protein synthesis. This protein is also activated by manganese ions and heparin. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

PKR: a protein kinase of the PEK family. Upon binding double-stranded RNA, it becomes autophosphorylated and activated. Phosphorylates and inhibits the alpha subunit of eIF2 alpha, which leads to an inhibition of the initiation of protein synthesis. Controls the activation of several transcription factors such as NF-kappaB, p53 and Stats. Mediates apoptosis induced by many different stimuli, such as LPS, TNF-alpha, viral infection and serum starvation.

Protein type: Kinase, protein; Translation; EC 2.7.11.1; Protein kinase, Other; EC 2.7.10.2; Protein kinase, Ser/Thr (non-receptor); Other group; PEK family

Chromosomal Location of Human Ortholog: 2p22-p21

Cellular Component: membrane; perinuclear region of cytoplasm; cytoplasm; ribosome; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; double-stranded RNA binding; non-membrane spanning protein tyrosine kinase activity; protein phosphatase type 2A regulator activity; ATP binding; eukaryotic translation initiation factor 2alpha kinase activity; protein kinase activity

Biological Process: positive regulation of cytokine production; peptidyl-tyrosine phosphorylation; translation; transcription, DNA-dependent; activation of MAPKK activity; unfolded protein response; response to virus; protein amino acid autophosphorylation; viral infectious cycle; protein amino acid phosphorylation; positive regulation of stress-activated MAPK cascade; positive regulation of chemokine production; evasion by virus of host immune response; activation of NF-kappaB transcription factor; negative regulation of cell proliferation; negative regulation of viral genome replication; modification by virus of host cellular process; virus-host interaction; negative regulation of translation; innate immune response; negative regulation of osteoblast proliferation; defense response to virus; negative regulation of apoptosis

Research Articles on EIF2AK2

Similar Products

Product Notes

The EIF2AK2 eif2ak2 (Catalog #AAA6232641) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EIF2AK2 (PKR, PRKR, Interferon-induced, Double-stranded RNA-activated Protein Kinase, Eukaryotic Translation Initiation Factor 2-alpha Kinase 2, Interferon-inducible RNA-dependent Protein Kinase, P1/eIF-2A Protein Kinase, Protein Kinase RNA-activated, Tyr reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EIF2AK2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EIF2AK2 eif2ak2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EIF2AK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.