Mouse anti-Human EHD3 Monoclonal Antibody | anti-EHD3 antibody
EHD3 (EH Domain-containing Protein 3, PAST Homolog 3, EHD2, PAST3) (MaxLight 550)
Gene Names
EHD3; PAST3
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EHD3; Monoclonal Antibody; EHD3 (EH Domain-containing Protein 3; PAST Homolog 3; EHD2; PAST3) (MaxLight 550); anti-EHD3 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B7
Specificity
Recognizes human EHD3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-EHD3 antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 25ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa357-407 from human EHD3 (NP_055415) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-EHD3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
61 kDa
NCBI Official Full Name
EH domain-containing protein 3
NCBI Official Synonym Full Names
EH domain containing 3
NCBI Official Symbol
EHD3
NCBI Official Synonym Symbols
PAST3
NCBI Protein Information
EH domain-containing protein 3
UniProt Protein Name
EH domain-containing protein 2
Protein Family
UniProt Gene Name
EHD2
UniProt Entry Name
EHD2_HUMAN
Uniprot Description
EHD2: Plays a role in membrane reorganization in response to nucleotide hydrolysis. Binds to liposomes and deforms them into tubules. Plays a role in membrane trafficking between the plasma membrane and endosomes. Important for the internalization of GLUT4. Required for normal fusion of myoblasts to skeletal muscle myotubes. Binds ATP; does not bind GTP.
Protein type: Vesicle
Chromosomal Location of Human Ortholog: 19q13.3
Cellular Component: caveola; cytosol; endosome membrane; extrinsic to membrane; nucleus; perinuclear region of cytoplasm; plasma membrane; recycling endosome membrane
Molecular Function: ATP binding; calcium ion binding; GTP binding; hydrolase activity; nucleic acid binding; protein binding; protein domain specific binding
Biological Process: blood coagulation; cortical actin cytoskeleton organization and biogenesis; endocytic recycling; endocytosis; metabolic process
Research Articles on EHD3
Similar Products
Product Notes
The EHD3 ehd2 (Catalog #AAA6211286) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EHD3 (EH Domain-containing Protein 3, PAST Homolog 3, EHD2, PAST3) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EHD3 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 25ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EHD3 ehd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EHD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
