Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (31.61kD).)

Mouse anti-Human EHD3 Monoclonal Antibody | anti-EHD3 antibody

EHD3 (EH Domain-containing Protein 3, PAST Homolog 3, EHD2, PAST3) (Biotin)

Gene Names
EHD3; PAST3
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EHD3; Monoclonal Antibody; EHD3 (EH Domain-containing Protein 3; PAST Homolog 3; EHD2; PAST3) (Biotin); anti-EHD3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4B7
Specificity
Recognizes human EHD3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-EHD3 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 25ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa357-407 from human EHD3 (NP_055415) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.61kD).)

Western Blot (WB) (Western Blot detection against Immunogen (31.61kD).)

Western Blot (WB)

(EHD3 monoclonal antibody. Western Blot analysis of EHD3 expression in MCF-7.)

Western Blot (WB) (EHD3 monoclonal antibody. Western Blot analysis of EHD3 expression in MCF-7.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to EHD3 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to EHD3 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to EHD3 on HeLa cell. [antibody concentration 25ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to EHD3 on HeLa cell. [antibody concentration 25ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged EHD3 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EHD3 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(EHD3 monoclonal antibody, Western Blot analysis of EHD3 expression in IMR-32.)

Western Blot (WB) (EHD3 monoclonal antibody, Western Blot analysis of EHD3 expression in IMR-32.)

Western Blot (WB)

(EHD3 monoclonal antibody. Western Blot analysis of EHD3 expression in COLO 320 HSR.)

Western Blot (WB) (EHD3 monoclonal antibody. Western Blot analysis of EHD3 expression in COLO 320 HSR.)
Product Categories/Family for anti-EHD3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61 kDa
NCBI Official Full Name
EH domain-containing protein 3
NCBI Official Synonym Full Names
EH domain containing 3
NCBI Official Symbol
EHD3
NCBI Official Synonym Symbols
PAST3
NCBI Protein Information
EH domain-containing protein 3
UniProt Protein Name
EH domain-containing protein 2
UniProt Gene Name
EHD2
UniProt Entry Name
EHD2_HUMAN

Uniprot Description

EHD2: Plays a role in membrane reorganization in response to nucleotide hydrolysis. Binds to liposomes and deforms them into tubules. Plays a role in membrane trafficking between the plasma membrane and endosomes. Important for the internalization of GLUT4. Required for normal fusion of myoblasts to skeletal muscle myotubes. Binds ATP; does not bind GTP.

Protein type: Vesicle

Chromosomal Location of Human Ortholog: 19q13.3

Cellular Component: caveola; cytosol; endosome membrane; extrinsic to membrane; nucleus; perinuclear region of cytoplasm; plasma membrane; recycling endosome membrane

Molecular Function: ATP binding; calcium ion binding; GTP binding; hydrolase activity; nucleic acid binding; protein binding; protein domain specific binding

Biological Process: blood coagulation; cortical actin cytoskeleton organization and biogenesis; endocytic recycling; endocytosis; metabolic process

Research Articles on EHD3

Similar Products

Product Notes

The EHD3 ehd2 (Catalog #AAA6141679) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EHD3 (EH Domain-containing Protein 3, PAST Homolog 3, EHD2, PAST3) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EHD3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 25ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EHD3 ehd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EHD3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.