Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human, Rat EGR2 Monoclonal Antibody | anti-EGR2 antibody

EGR2 (Early Growth Response Protein 2, EGR-2, AT591, Zinc Finger Protein Krox-20, KROX20, DKFZp686J1957, FLJ14547) (MaxLight 650)

Gene Names
EGR2; AT591; CMT1D; CMT4E; KROX20
Reactivity
Human, Rat
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EGR2; Monoclonal Antibody; EGR2 (Early Growth Response Protein 2; EGR-2; AT591; Zinc Finger Protein Krox-20; KROX20; DKFZp686J1957; FLJ14547) (MaxLight 650); anti-EGR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G5
Specificity
Recognizes human EGR2. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-EGR2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa217-293 from human EGR2 (NP_000390.2) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-EGR2 antibody
The EGR2 gene provides instructions for making a protein called early growth response 2, which is part of the early growth response family of proteins. These proteins bind to specific areas of DNA and help control the activity of particular genes. On the basis of this action, the proteins are referred to as transcription factors. The early growth response 2 protein activates several genes that are involved in the formation and maintenance of myelin, the fatty substance that covers and protects nerve cells. Myelin promotes the efficient transmission of nerve impulses. If myelin is lost (demyelination) or its structure is disrupted, the transmission of nerve impulses is impaired. Mutations in the EGR2 gene can cause two forms of Charcot-Marie-Tooth disease, type 1D or type 4E (sometimes called congenital hypomyelinating neuropathy) or a severe form of type 1D (sometimes called Dejerine-Sottas syndrome) that begins during infancy or early childhood.
Product Categories/Family for anti-EGR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
50,302 Da
NCBI Official Full Name
E3 SUMO-protein ligase EGR2 isoform a
NCBI Official Synonym Full Names
early growth response 2
NCBI Official Symbol
EGR2
NCBI Official Synonym Symbols
AT591; CMT1D; CMT4E; KROX20
NCBI Protein Information
E3 SUMO-protein ligase EGR2; zinc finger protein Krox-20; early growth response protein 2; KROX-20, Drosophila, homolog (early growth response-2)
UniProt Protein Name
E3 SUMO-protein ligase EGR2
Protein Family
UniProt Gene Name
EGR2
UniProt Synonym Gene Names
KROX20; EGR-2
UniProt Entry Name
EGR2_HUMAN

Uniprot Description

EGR2: Sequence-specific DNA-binding transcription factor. Binds to two specific DNA sites located in the promoter region of HOXA4. Defects in EGR2 are a cause of congenital hypomyelination neuropathy (CHN). Inheritance can be autosomal dominant or recessive. Recessive CHN is also known as Charcot- Marie-Tooth disease type 4E (CMT4E). CHN is characterized clinically by early onset of hypotonia, areflexia, distal muscle weakness, and very slow nerve conduction velocities. Defects in EGR2 are a cause of Charcot-Marie-Tooth disease type 1D (CMT1D). CMT1D is a form of Charcot- Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet. Defects in EGR2 are a cause of Dejerine-Sottas syndrome (DSS); also known as Dejerine-Sottas neuropathy (DSN) or hereditary motor and sensory neuropathy III (HMSN3). DSS is a severe degenerating neuropathy of the demyelinating Charcot-Marie- Tooth disease category, with onset by age 2 years. DSS is characterized by motor and sensory neuropathy with very slow nerve conduction velocities, increased cerebrospinal fluid protein concentrations, hypertrophic nerve changes, delayed age of walking as well as areflexia. There are both autosomal dominant and autosomal recessive forms of Dejerine-Sottas syndrome. Belongs to the EGR C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; C2H2-type zinc finger protein; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 10q21.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; ubiquitin protein ligase binding; metal ion binding; chromatin binding; transcription factor activity; ligase activity

Biological Process: myelination; transcription from RNA polymerase II promoter; fat cell differentiation; facial nerve structural organization; rhombomere 5 formation; positive regulation of transcription, DNA-dependent; motor axon guidance; response to insulin stimulus; peripheral nervous system development; Schwann cell differentiation; rhythmic behavior; protein sumoylation; learning and/or memory; rhombomere 3 formation; positive regulation of transcription from RNA polymerase II promoter; brain development; protein export from nucleus; regulation of ossification; brain segmentation; regulation of neuronal synaptic plasticity; negative regulation of apoptosis

Disease: Neuropathy, Congenital Hypomyelinating Or Amyelinating, Autosomal Recessive; Hypertrophic Neuropathy Of Dejerine-sottas; Charcot-marie-tooth Disease, Demyelinating, Type 1d

Similar Products

Product Notes

The EGR2 egr2 (Catalog #AAA6221960) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EGR2 (Early Growth Response Protein 2, EGR-2, AT591, Zinc Finger Protein Krox-20, KROX20, DKFZp686J1957, FLJ14547) (MaxLight 650) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EGR2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EGR2 egr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EGR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.