Mouse anti-Human, Rat EGR2 Monoclonal Antibody | anti-EGR2 antibody

EGR2 (Early Growth Response Protein 2, EGR-2, AT591, Zinc Finger Protein Krox-20, KROX20, DKFZp686J1957, FLJ14547) (HRP)

Cat. Num. AAA6152284

• Gene Names: EGR2; AT591; CMT1D; CMT4E; KROX20
• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: EGR2; Monoclonal Antibody; EGR2 (Early Growth Response Protein 2; EGR-2; AT591; Zinc Finger Protein Krox-20; KROX20; DKFZp686J1957; FLJ14547) (HRP); anti-EGR2 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1G5
• Specificity: Recognizes human EGR2. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-EGR2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa217-293 from human EGR2 (NP_000390.2) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PGLFPMIPDYPGFFPSQCQRDLHGTAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPR
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.21kD).)

Western Blot (WB)

(EGR2 monoclonal antibody. Western Blot analysis of EGR2 expression in rat brain.)

Related Product Information for anti-EGR2 antibody

The EGR2 gene provides instructions for making a protein called early growth response 2, which is part of the early growth response family of proteins. These proteins bind to specific areas of DNA and help control the activity of particular genes. On the basis of this action, the proteins are referred to as transcription factors. The early growth response 2 protein activates several genes that are involved in the formation and maintenance of myelin, the fatty substance that covers and protects nerve cells. Myelin promotes the efficient transmission of nerve impulses. If myelin is lost (demyelination) or its structure is disrupted, the transmission of nerve impulses is impaired. Mutations in the EGR2 gene can cause two forms of Charcot-Marie-Tooth disease, type 1D or type 4E (sometimes called congenital hypomyelinating neuropathy) or a severe form of type 1D (sometimes called Dejerine-Sottas syndrome) that begins during infancy or early childhood.

Product Categories/Family for anti-EGR2 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 9845524
• NCBI GeneID: 1959
• NCBI Accession #: NP_000390.2
• NCBI GenBank Nucleotide #: NM_000399
• UniProt Accession #: P11161; Q68CZ5; Q8IV26; Q9UNA6; B2R724; B3KRD7
• Molecular Weight: 50,302 Da
• NCBI Official Full Name: E3 SUMO-protein ligase EGR2 isoform a
• NCBI Official Synonym Full Names: early growth response 2
• NCBI Official Symbol: EGR2
• NCBI Official Synonym Symbols: AT591; CMT1D; CMT4E; KROX20
• NCBI Protein Information: E3 SUMO-protein ligase EGR2; zinc finger protein Krox-20; early growth response protein 2; KROX-20, Drosophila, homolog (early growth response-2)
• UniProt Protein Name: E3 SUMO-protein ligase EGR2
• Protein Family: E3 SUMO-protein ligase
• UniProt Gene Name: EGR2
• UniProt Synonym Gene Names: KROX20; EGR-2
• UniProt Entry Name: EGR2_HUMAN

Uniprot Description

EGR2: Sequence-specific DNA-binding transcription factor. Binds to two specific DNA sites located in the promoter region of HOXA4. Defects in EGR2 are a cause of congenital hypomyelination neuropathy (CHN). Inheritance can be autosomal dominant or recessive. Recessive CHN is also known as Charcot- Marie-Tooth disease type 4E (CMT4E). CHN is characterized clinically by early onset of hypotonia, areflexia, distal muscle weakness, and very slow nerve conduction velocities. Defects in EGR2 are a cause of Charcot-Marie-Tooth disease type 1D (CMT1D). CMT1D is a form of Charcot- Marie-Tooth disease, the most common inherited disorder of the peripheral nervous system. Charcot-Marie-Tooth disease is classified in two main groups on the basis of electrophysiologic properties and histopathology: primary peripheral demyelinating neuropathy or CMT1, and primary peripheral axonal neuropathy or CMT2. Neuropathies of the CMT1 group are characterized by severely reduced nerve conduction velocities (less than 38 m/sec), segmental demyelination and remyelination with onion bulb formations on nerve biopsy, slowly progressive distal muscle atrophy and weakness, absent deep tendon reflexes, and hollow feet. Defects in EGR2 are a cause of Dejerine-Sottas syndrome (DSS); also known as Dejerine-Sottas neuropathy (DSN) or hereditary motor and sensory neuropathy III (HMSN3). DSS is a severe degenerating neuropathy of the demyelinating Charcot-Marie- Tooth disease category, with onset by age 2 years. DSS is characterized by motor and sensory neuropathy with very slow nerve conduction velocities, increased cerebrospinal fluid protein concentrations, hypertrophic nerve changes, delayed age of walking as well as areflexia. There are both autosomal dominant and autosomal recessive forms of Dejerine-Sottas syndrome. Belongs to the EGR C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; C2H2-type zinc finger protein; EC 6.3.2.-

Chromosomal Location of Human Ortholog: 10q21.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; ubiquitin protein ligase binding; metal ion binding; chromatin binding; transcription factor activity; ligase activity

Biological Process: myelination; transcription from RNA polymerase II promoter; fat cell differentiation; facial nerve structural organization; rhombomere 5 formation; positive regulation of transcription, DNA-dependent; motor axon guidance; response to insulin stimulus; peripheral nervous system development; Schwann cell differentiation; rhythmic behavior; protein sumoylation; learning and/or memory; rhombomere 3 formation; positive regulation of transcription from RNA polymerase II promoter; brain development; protein export from nucleus; regulation of ossification; brain segmentation; regulation of neuronal synaptic plasticity; negative regulation of apoptosis

Disease: Neuropathy, Congenital Hypomyelinating Or Amyelinating, Autosomal Recessive; Hypertrophic Neuropathy Of Dejerine-sottas; Charcot-marie-tooth Disease, Demyelinating, Type 1d