Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human, Mouse EFNA5 Monoclonal Antibody | anti-EFNA5 antibody

EFNA5 (Ephrin A5, Ephrin-A5, AL-1, EPH-related Receptor Tyrosine Kinase Ligand 7, LERK-7, EPLG7, LERK7) APC

Gene Names
EFNA5; AF1; EFL5; RAGS; EPLG7; GLC1M; LERK7
Reactivity
Human, Mouse
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EFNA5; Monoclonal Antibody; EFNA5 (Ephrin A5; Ephrin-A5; AL-1; EPH-related Receptor Tyrosine Kinase Ligand 7; LERK-7; EPLG7; LERK7) APC; anti-EFNA5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1F12
Specificity
Recognizes human EFNA5. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-EFNA5 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa114-203 from EFNA5 (NP_001953) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB)

(EFNA5 monoclonal antibody, Western Blot analysis of EFNA5 expression in NIH/3T3.)

Western Blot (WB) (EFNA5 monoclonal antibody, Western Blot analysis of EFNA5 expression in NIH/3T3.)

Testing Data

(Detection limit for recombinant GST tagged EFNA5 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged EFNA5 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-EFNA5 antibody
Ephrin-A5 is a member of the ephrin (EPH) gene family. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. Ephrin-A5 prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation.
Product Categories/Family for anti-EFNA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48.1kDa (422aa) 40-57kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
ephrin-A5
NCBI Official Synonym Full Names
ephrin A5
NCBI Official Symbol
EFNA5
NCBI Official Synonym Symbols
AF1; EFL5; RAGS; EPLG7; GLC1M; LERK7
NCBI Protein Information
ephrin-A5
UniProt Protein Name
Ephrin-A5
Protein Family
UniProt Gene Name
EFNA5
UniProt Synonym Gene Names
EPLG7; LERK7; LERK-7
UniProt Entry Name
EFNA5_HUMAN

NCBI Description

Ephrin-A5, a member of the ephrin gene family, prevents axon bundling in cocultures of cortical neurons with astrocytes, a model of late stage nervous system development and differentiation. The EPH and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, particularly in the nervous system. EPH receptors typically have a single kinase domain and an extracellular region containing a Cys-rich domain and 2 fibronectin type III repeats. The ephrin ligands and receptors have been named by the Eph Nomenclature Committee (1997). Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are similarly divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. [provided by RefSeq, Jul 2008]

Uniprot Description

EFNA5: Cell surface GPI-bound ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Induces compartmentalized signaling within a caveolae-like membrane microdomain when bound to the extracellular domain of its cognate receptor. This signaling event requires the activity of the Fyn tyrosine kinase. Activates the EPHA3 receptor to regulate cell-cell adhesion and cytoskeletal organization. With the receptor EPHA2 may regulate lens fiber cells shape and interactions and be important for lens transparency maintenance. May function actively to stimulate axon fasciculation. The interaction of EFNA5 with EPHA5 also mediates communication between pancreatic islet cells to regulate glucose-stimulated insulin secretion. Cognate/functional ligand for EPHA7, their interaction regulates brain development modulating cell-cell adhesion and repulsion. Belongs to the ephrin family.

Protein type: Cell development/differentiation; Ligand, receptor tyrosine kinase; Motility/polarity/chemotaxis; Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 5q21

Cellular Component: anchored to external side of plasma membrane; extracellular region; plasma membrane; caveola

Molecular Function: ephrin receptor binding; chemorepellent activity

Biological Process: nervous system development; axon guidance; positive regulation of peptidyl-tyrosine phosphorylation; regulation of cell-cell adhesion; apoptosis; regulation of actin cytoskeleton organization and biogenesis; regulation of focal adhesion formation; ephrin receptor signaling pathway; negative chemotaxis; retinal ganglion cell axon guidance

Research Articles on EFNA5

Similar Products

Product Notes

The EFNA5 efna5 (Catalog #AAA6136369) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The EFNA5 (Ephrin A5, Ephrin-A5, AL-1, EPH-related Receptor Tyrosine Kinase Ligand 7, LERK-7, EPLG7, LERK7) APC reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's EFNA5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EFNA5 efna5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EFNA5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.